About Products Protein Database Contact

RT0380

Gene
RT0380
Protein
Probable intracellular septation protein A
Organism
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Length
180 amino acids
Function
Involved in cell division; probably involved in intracellular septation.
Similarity
Belongs to the YciB family.
Mass
20.464 kDa
Sequence
MLKLLSEIGPVIAFFAGFFYGGGIQSATLYMLITSIICITLCYIIDKKVSKLSIISSTVLFVSGIITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWIILSYRTAAFFFFMAVVNEVVWRNFSDETWVKFKVFGVIPITFIFILLQLPLLLKNKLPDSKI