About Products Protein Database Contact

RSKD131_2883

Gene
RSKD131_2883
Protein
UPF0434 protein RSKD131_2883
Organism
Rhodobacter sphaeroides (strain KD131 / KCTC 12085)
Length
59 amino acids
Similarity
Belongs to the UPF0434 family.
Mass
6.593 kDa
Sequence
MTGTTLFDRRMLEALVCPVTQAGLAYDADRQELISKQARLAFPIRDGIPIMLVSEAREL