About Products Protein Database Contact

RSKD131_2455

Gene
RSKD131_2455
Protein
Putative membrane protein insertion efficiency factor
Organism
Rhodobacter sphaeroides (strain KD131 / KCTC 12085)
Length
84 amino acids
Function
Could be involved in insertion of integral membrane proteins into the membrane.
Similarity
Belongs to the UPF0161 family.
Mass
9.202 kDa
Sequence
MSPLAQVLALPVRAYRLLLSPWVGHGCRYQPTCSVYALDALERHGALKGGWLAARRILSCHPWGGSGYDPVPGADPEHDRRPRG