RPN11

26S proteasome regulatory subunit RPN11

311 amino acids

Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.

Belongs to the peptidase M67A family.

35.202 kDa

MDRLQRLMMSQRSNMIGAAATEMPLDDTKETVYISSLALLKMLKHSRAGVPMEVMGLMLGDFVDEYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVDTQRSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLISPATVVRNQEPRQTTSNVGLLNKPNIQSLIHGLNRHYYSLNIDYHKTSAELNMLMNLHKEQWQSGLKMHDYKEKERINLEATKKSVRIAEQYTKRIEEEKELTEDELKTRYVGKQDPKKHLSETAERVLEENIVSVLTAGVNSVAIK

RPN11

26S proteasome non-ATPase regulatory subunit 14 homolog

308 amino acids

Metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. The function of the 'Lys-63'-specific deubiquitination of the proteasome is unclear (By similarity).

Belongs to the peptidase M67A family. PSMD14 subfamily.

34.353 kDa

MERLQRIFGAGGGLGHASPDSPTLDTSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALNQRAVAVVVDPIQSVKGKVVIDAFRSINPQTIMLGQEPRQTTSNLGHLNKPSIQALIHGLNRHYYSIAINYRKNELEEKMLLNLHKKKWTDGLTLRRFDTHSKTNEQTVQEMLSLAAKYNKAVQEEDELSPEKLAIVNVGRQDAKKHLEEHVSNLMSSNIVQTLGTMLDTVVF

Rpn11

26S proteasome non-ATPase regulatory subunit 14

308 amino acids

Metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. The function of the 'Lys-63'-specific deubiquitination of the proteasome is unclear (By similarity).

Belongs to the peptidase M67A family. PSMD14 subfamily.

34.401 kDa

MDRLLRLGGAMPQAAPPTDAPVVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVQVIDVFAMPQTGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINPNMLVLGQEPRQTTSNLGHLQKPSVQALIHGLNRHYYSISINYRKNELEQKMLLNLHKKSWKDGLTLSDYNEHCSINEDTVAEMLDLAKNYNKSLEDEEKMTPEQLAIKNVGKQDPKRHLEEKVDKVMQNNIVQCLGAMLDTIVFK

rpn11

26S proteasome regulatory subunit rpn11

308 amino acids

Transcription factor pap1 is controlled by the functional interaction between the positive regulator pad1 and negative regulator crm1. Both these proteins are also essential for cell viability and for the maintenance of chromosome structure. Pad1 is also responsible for resistance to staurosporine, and other drugs such as cycloheximide and caffeine.

Belongs to the peptidase M67A family.

34.572 kDa

MESLQRLLQGARMGTGMMGDQPLVDNSECVYISSLALLKMLRHGRHGTPMEVMGLMLGEFVDDFTVRVVDVFAMPQSGTGVSVEAVDPVFQKNMMDMLKQTGRPEMVVGWYHSHPGFGCWLSSVDINTQQSFEQLTPRAVAVVVDPIQSVKGKVVIDAFRLINPSTLMMGQEPRQTTSNLGHINKPSIQALIHGLGRHYYSLRINYKKTELEEIMLLNLHKQPWAHGLLLENFNSAAEKNHASIDKMKSLSEQYTERVQNEVTLSPEQLRIQYVGKQDPKKHLDAEVQKCIDNNISSMLACMLDSVAF

RPN11

26S proteasome regulatory subunit RPN11

306 amino acids

Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.

Belongs to the peptidase M67A family.

34.424 kDa

MERLQRLMMNTKVGAADANKDDTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVNVVDVFAMPQSGTGVSVEAVDDVFQARMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNNRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNQEPRQTTSNSGLMNKANIQALIHGLNRHYYSLNIDYHKTPAETKMLLNLHKEQWQSGLKMQDYQEKETENLEATKRMVAVAQQYSKRIEEEKELSEEELKTRYVGKQDPKKHLAKTAENTLEENTVSVLTAGVNSIAIK

RPN11

Ubiquitin carboxyl-terminal hydrolase RPN11

306 amino acids

Component of the lid subcomplex of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. RPN11 is the only catalytically active member of the lid and serves as the essential deubiquitinase of the proteasome.

Belongs to the peptidase M67A family.

34.398 kDa

MERLQRLMMNSKVGSADTGRDDTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNLEPRQTTSNTGLLNKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLHKEQWQSGLKMYDYEEKEESNLAATKSMVKIAEQYSKRIEEEKELTEEELKTRYVGRQDPKKHLSETADETLENNIVSVLTAGVNSVAIK

RPN11

26S proteasome regulatory subunit RPN11

294 amino acids

Acts as a regulatory subunit of the 26S proteasome which degrades poly-ubiquitinated proteins in the cytoplasm and in the nucleus. It is essential for the regulated turnover of proteins and for the removal of misfolded proteins. The proteasome is a multicatalytic proteinase complex that is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH (By similarity).

Belongs to the peptidase M67A family.

33.173 kDa

MFSGFVGPDDGEPTSDASETVQISSLALLKMLKHGRAGIPLEVMGLMLGEFVDEYTVKVVDVFAMPQSGTNVTVESVDPIFQMEMMSILKATGRHETVVGWYHSHPGFGCWLSTVDISTQQSFEKLCKRAVAVVVDPIQSVKGKVVIDAFRLIDNQLGVLGGEPRQVTSNIGYLKTPTLISIIHGLNKHYYSFNITCRKNDFEQKMLLNLHRKTWADNLKLGDVRSKREEALKLIESYGKAFEEEKNLAGKNPDMAKVGRIDYRRRLLEKCEESIMENTIYSLLYSIHRYIFTQ