RPL12A

50S ribosomal protein L12-1, chloroplastic

191 amino acids

Belongs to the bacterial ribosomal protein bL12 family.

20.075 kDa

MASTTLSIATTIRSSSYPTLASINHFPSRTTTIEFPSRFGGGSSSTLTHRATHLRPIAAVEAPEKIEKIGSEISSLTLEEARILVDYLQDKFGVSPLSLAPAAAAVAAPADGGAAAVVEEQTEFDVVINEVPSSSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGITKDEAEEAKKTLEEAGAKVSIA

RPL12A

60S ribosomal protein L12-1

166 amino acids

Binds directly to 26S ribosomal RNA.

Belongs to the universal ribosomal protein uL11 family.

17.942 kDa

MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVTEIARIMRPRSIAKELSGTVREILGTCVSVGCTVDGKDPKDIQQEIQDGEVEIPEN

RPL12A

60S ribosomal protein L12-A

165 amino acids

Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel.

Belongs to the universal ribosomal protein uL11 family.

17.823 kDa

MPPKFDPNEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGEDIAKATKEFKGIKVTVQLKIQNRQAAASVVPSASSLVITALKEPPRDRKKDKNVKHSGNIQLDEIIEIARQMRDKSFGRTLASVTKEILGTAQSVGCRVDFKNPHDIIEGINAGEIEIPEN