RPAIN

RPA-interacting protein

219 amino acids

Mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. Isoform 2 is sumoylated and mediates the localization of RPA complex into the PML body of the nucleus, thereby participating in RPA function in DNA metabolism.

24.77 kDa

MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWNALQSVENCPEDLAQLEELIDMAVLEEIQQELINQEQSIISEYEKSLQFDEKCLSIMLAEWEANPLICPVCTKYNLRITSGVVVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEEKSSLLMSCLACDTWAVIL

Rpain

RPA-interacting protein

219 amino acids

Mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. Sumoylation mediates the localization of RPA complex into the PML body of the nucleus, thereby participating in RPA function in DNA metabolism (By similarity).

24.897 kDa

MAESSGSPHRLLYKQVGSPHWKETFRQGCLERMRNSRHRLLNKYRQAAGSTPGTASDRLLVQEVMEEEWASLQSVENCPEALLQLELPLDLAVLQDIEQELCNEEKSIISEYEEDLEFDESCLRRMLAEWEANSLICPVCIKYNLRIMNSVVTCPCGLHIPVHSTDLTEQKLRACLEENVNEHSVHCPHTPVFSVTGGTEEKPSLLMNCLTCDTWAVIL

Rpain

RPA-interacting protein

219 amino acids

Mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. Sumoylation mediates the localization of RPA complex into the PML body of the nucleus, thereby participating in RPA function in DNA metabolism (By similarity).

24.71 kDa

MAESSGSPHRLLYKQVGSPPWKETFRQGCLERMRNSRHKLLNRYRQAAGSTLGTASDRLLVQEVMEEEWNSLQSVENCPEALLQLELPLNLAVLQDIEQELWNEEKSIISEYEKGLQFDESCLNSMLAEWEANPLICPVCIKYNLRIMNSVVTCPCGLHIPSHSTDLTEQKLRACLEGNVNEHSAHCPHIPEFSVTGGTEEKPSLLMSCLACDTWAVIL