RNF183

E3 ubiquitin-protein ligase RNF183

192 amino acids

Acts as a E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins (PubMed:29507230). Triggers apoptosis in response to prolonged ER stress by mediating the polyubiquitination and subsequent proteasomal degradation of BCL2L1 (PubMed:29507230). May collaborate with FATE1 to restrain BIK protein levels thus regulating apoptotic signaling (PubMed:26567849).

21.617 kDa

MAEQQGRELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTDTAMLALLRLEPHHVILEGHQLCLKDQPKSRYFLRQPQVYTLDLGPQPGGQTGPPPDTASATVSTPILIPSHHSLRECFRNPQFRIFAYLMAVILSVTLLLIFSIFWTKQFLWGVG

Rnf183

E3 ubiquitin-protein ligase RNF183

190 amino acids

Acts as a E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins (PubMed:29300766). Triggers apoptosis in response to prolonged ER stress by mediating the polyubiquitination and subsequent proteasomal degradation of BCL2L1 (By similarity). May collaborate with FATE1 to restrain BIK protein levels thus regulating apoptotic signaling (By similarity).

21.625 kDa

MSEPQGQELRAECPVCWNPFNNTFHTPKVLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTDTAMLTLLRLEPHHVILEGHQLCLKDQPKSRYFLRQPRVYTLDLGAEPGSQTGLPQDTAPDTRPVPIPSHYSLRECVRNPHFRIFAYLMAVILSVTLLLIFSIFWTKQFFWGMG

RNF183

E3 ubiquitin-protein ligase RNF183

188 amino acids

Acts as a E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Triggers apoptosis in response to prolonged ER stress by mediating the polyubiquitination and subsequent proteasomal degradation of BCL2L1. May collaborate with FATE1 to restrain BIK protein levels thus regulating apoptotic signaling.

21.492 kDa

MAEQQGREPECPVCWNPFNNTFHTPKVLDCCHSFCVECLAHISLVTPTRRRLLCPLCRHPTVLASGQPVTDLPTDTAVLTLLRLEPHHVILEGHQLCLKDQPKSRYFLRQPRVYTLDLGPEPASQAGQPQDVGPSTRPVPIRSRYSLRECFRNPHFRIFAYMMAVILCGTVLFIFSIFCTRRFFWGVG