RL1

Uncharacterized protein HKLF1

310 amino acids

Belongs to the HHV-5 HKLF1 family.

34.733 kDa

MPATDTNSTHTTPLHPEDQHTLPLHHSTTQPHVQTSDKHADKQHRTQMELDAADYAACAQARQHLYGQTQPQLHAYPNANPQESAHFRTENQHQLTNLLHNIGEGAALGYPVPRAEIRRGGGDWADSASDFDADCWCMWGRFGTMGRQPVVTLLLARQRDGLADWNVVRCRGTGFRAHDSEDGVSVWRQHLVFLLGGHGRRVQLERPSAGEAQARGLLPRIRITPISTSPRPKPPQPTTSTASHPHATARPDHTLFPVPSTPSATVHNPRNYAVQLHAETTRTWRWARRGERGAWMPAETFTCPKDKRPW

RL1

Neurovirulence factor ICP34.5

263 amino acids

Plays essential roles in viral nuclear egress to mediate capsid transit across the nuclear membrane and also in the inhibition of host immune response. Facilitates nuclear egress cooperatively with host C1QBP and protein kinase C/PKC to induce lamin A/C phosphorylation and subsequent reorganization. In turn, lamina disassembles and nuclear egress occurs. Recruits the serine/threonine protein phosphatase PPP1CA/PP1-alpha to dephosphorylate the translation initiation factor eIF-2A, thereby couteracting the host shutoff of protein synthesis involving double-stranded RNA-dependent protein kinase EIF2AK2/PKR. In turn, controls host IRF3 activation and subsequently inhibits host interferon response. Controls the DNA sensing pathway by interacting with and inhibiting host STING/TMEM173. Also down-modulates the host MHC class II proteins cell surface expression. Acts as a neurovirulence factor that has a profound effect on the growth of the virus in central nervous system tissue, by interqcting with host BECN1 and thereby antagonizing the host autophagy response.

Belongs to the PPP1R15 family.

27.533 kDa

MARRRRHRGPRRPRPPGPTGAVPTAQSQVTSTPNSEPAVRSAPAAAPPPPPASGPPPSCSLLLRQWLHVPESASDDDDDDDWPDSPPPEPAPEARPTAAAPRPRSPPPGAGPGGGANPSHPPSRPFRLPPRLALRLRVTAEHLARLRLRRAGGEGAPEPPATPATPATPATPATPATPATPATPATPATPARVRFSPHVRVRHLVVWASAARLARRGSWARERADRARFRRRVAEAEAVIGPCLGPEARARALARGAGPANSV

RL1

Neurovirulence factor ICP34.5

261 amino acids

Contributes to HSV resistance to the antiviral effects of alpha/beta interferon. Recruits the serine/threonine-protein phosphatase PPP1CA/PP1-alpha to dephosphorylate the translation initiation factor eIF-2A, thereby couteracting the host shutoff of protein synthesis involving double-stranded RNA-dependent protein kinase EIF2AK2/PKR. Also down-modulates the host MHC class II proteins cell surface expression. Acts as a neurovirulence factor that has a profound effect on the growth of the virus in central nervous system tissue, probably through its ability to maintain an environment favorable for viral replication (By similarity).

Belongs to the PPP1R15 family.

27.908 kDa

MSRRRGPRRRGPRRRPRPGAPAVPRPGAPAVPRPGALPTADSQMVPAYDSGTAVESAPAASSLLRRWLLVPQADDSDDADYAGNDDAEWANSPPSEGGGKAPEAPHAAPAAACPPPPPRKERGPQRPLPPHLALRLRTTTEYLARLSLRRRRPPASPPADAPRGKVCFSPRVQVRHLVAWETAARLARRGSWARERADRDRFRRRVAAAEAVIGPCLEPEARARARARARAHEDGGPAEEEEAAAAARGSSAAAGPGRRAV

RL1

Neurovirulence factor ICP34.5

252 amino acids

Plays essential roles in viral nuclear egress to mediate capsid transit across the nuclear membrane and also in the inhibition of host immune response. Facilitates nuclear egress cooperatively with host C1QBP and protein kinase C/PKC to induce lamin A/C phosphorylation and subsequent reorganization. In turn, lamina disassembles and nuclear egress occurs. Recruits the serine/threonine protein phosphatase PPP1CA/PP1-alpha to dephosphorylate the translation initiation factor eIF-2A, thereby couteracting the host shutoff of protein synthesis involving double-stranded RNA-dependent protein kinase EIF2AK2/PKR. In turn, controls host IRF3 activation and subsequently inhibits host interferon response. Controls the DNA sensing pathway by interacting with and inhibiting host STING/TMEM173. Also down-modulates the host MHC class II proteins cell surface expression. Acts as a neurovirulence factor that has a profound effect on the growth of the virus in central nervous system tissue, by interqcting with host BECN1 and thereby antagonizing the host autophagy response.

Belongs to the PPP1R15 family.

26.601 kDa

MARRRRRHRGPRRPRPPGPTGAVPTAQSQVTSTPNSEPVVRSAPAAAPPPPPAGGPPPSCSLLLRQWLQVPESASDDDDDDDWPDSPPPEPAPEARPTAAAPRPRSPPPGAGPGGGADPSHPPSRPFRLPPRLALRLRVTAEHLARLRLRRAGGEGAPEPPATPATPATPATPATPATPARVRFSPHVRVRHLVVWASAARLARRGSWARERADRARFRRRVAEAEAVIGPCLGPKARARALARGAGPANSV

RL1

Neurovirulence factor ICP34.5

245 amino acids

Plays essential roles in viral nuclear egress to mediate capsid transit across the nuclear membrane and also in the inhibition of host immune response. Facilitates nuclear egress cooperatively with host C1QBP and protein kinase C/PKC to induce lamin A/C phosphorylation and subsequent reorganization. In turn, lamina disassembles and nuclear egress occurs. Recruits the serine/threonine protein phosphatase PPP1CA/PP1-alpha to dephosphorylate the translation initiation factor eIF-2A, thereby couteracting the host shutoff of protein synthesis involving double-stranded RNA-dependent protein kinase EIF2AK2/PKR. In turn, controls host IRF3 activation and subsequently inhibits host interferon response. Controls the DNA sensing pathway by interacting with and inhibiting host STING/TMEM173. Also down-modulates the host MHC class II proteins cell surface expression. Acts as a neurovirulence factor that has a profound effect on the growth of the virus in central nervous system tissue, by interqcting with host BECN1 and thereby antagonizing the host autophagy response.

Belongs to the PPP1R15 family.

25.981 kDa

MARRRRRHRGPRRPRPPGPTGAVPTAQSQVTSTPNSEPVVRSAPAAGGPPPSCSLLLRQWLHVPESASDDDDDDDWPDSPPPEPAPEARPTAAAPRPRSPPPGAGPGGGANPSHPPSRPFRLPPRLALRLRVTAEHLARLRLRRAGGEGAPKPPATPATPATPATPATPATPARVRFSPHVRVRHLVVWASAARLARRGSWARERADRARFRRRVAEAEAVIGPCLGPEARARALARGAGPANSV

RL1

Protein RADIALIS-like 1

100 amino acids

Probable transcription factor.

11.296 kDa

MASSSMSSQSSGSWTAKQNKAFEQALATYDQDTPNRWQNVAKVVGGKTTEEVKRHYELLVQDINSIENGHVPFPNYRTSGGCTNGRLSQEEKRMRNMRLQ