RIC7

CRIB domain-containing protein RIC7

216 amino acids

Functions as downstream effector of Rho-related GTP binding proteins of the Rho of Plants (ROPs) family. Participates in the propagation of ROP GTPase signals in specific cellular responses. Functions as downstream effector of active ARAC4/ROP2 GTPase which is involved in the prevention of excessive stomatal opening upon light stimulation. Is involved in pollen tube growth regulation through its interaction with ARAC11/ROP1.

23.754 kDa

MQLGMSSTKMKSLLKGLRYISQVFAIEGEKEEEMQIGNPTDVKHVAHIGWDGPSDNATAPSWMNDFKSSPVMESIQGLGEDDSSVKCQSEFGGRTRDLPKLPKSTRKSSSEKGSPTKERSDKTKRRTSNKGTSSSRRTKDEDSTSSSRRTTKDEDSSLSQHSAGLPEVPKKSKRKKSKEAGNGGSSRSSRISEADYMSDTGSDRSMPQFEDDRNGF