rheb

GTP-binding protein Rheb homolog

185 amino acids

Binds GTP and exhibits intrinsic GTPase activity.

Belongs to the small GTPase superfamily. Rheb family.

20.715 kDa

MAPQKHRKICVMGSRAVGKSTITMQFVESHCPDSYHPTIENTYQKIIRHQGQEYSVEIIDTAGQDEYSILQKQYSIGIHGYILVYSVTSVSSLEVIKVLNDKILSSLGAEKIPRVLVGNKSDLDNERNISRDQGIQLANEWECAFVECSGKNNENVEEVFKQILNEVNKGSTGPEPPQKEGCILM

RHEB

GTP-binding protein Rheb

184 amino acids

Activates the protein kinase activity of mTORC1, and thereby plays a role in the regulation of apoptosis. Stimulates the phosphorylation of S6K1 and EIF4EBP1 through activation of mTORC1 signaling. Has low intrinsic GTPase activity (By similarity).

Belongs to the small GTPase superfamily. Rheb family.

20.479 kDa

MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIKNTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSSCSVM

RHEB

GTP-binding protein Rheb

184 amino acids

Activates the protein kinase activity of mTORC1, and thereby plays a role in the regulation of apoptosis. Stimulates the phosphorylation of S6K1 and EIF4EBP1 through activation of mTORC1 signaling. Has low intrinsic GTPase activity.

Belongs to the small GTPase superfamily. Rheb family.

20.497 kDa

MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSSCSVM

Rheb

GTP-binding protein Rheb

184 amino acids

Activates the protein kinase activity of mTORC1, and thereby plays a role in the regulation of apoptosis. Stimulates the phosphorylation of S6K1 and EIF4EBP1 through activation of mTORC1 signaling. Has low intrinsic GTPase activity.

Belongs to the small GTPase superfamily. Rheb family.

20.451 kDa

MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFKRIILEAEKIDGAASQGKSSCSVM

Rheb

GTP-binding protein Rheb

184 amino acids

Activates the protein kinase activity of mTORC1, and thereby plays a role in the regulation of apoptosis. Stimulates the phosphorylation of S6K1 and EIF4EBP1 through activation of mTORC1 signaling. Has low intrinsic GTPase activity.

Belongs to the small GTPase superfamily. Rheb family.

20.479 kDa

MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSSCSVM

Rheb

GTP-binding protein Rheb homolog

182 amino acids

Binds GTP and exhibits intrinsic GTPase activity (By similarity). Activates the protein kinase activity of TORC1, and thereby plays a role in the regulation of apoptosis (PubMed:22493059). Stimulates the phosphorylation of S6K through activation of TORC1 signaling (PubMed:22493059). May also have a role in activating TORC2 signaling (PubMed:22493059).

Belongs to the small GTPase superfamily. Rheb family.

20.731 kDa

MPTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIENENGNPQEKSGCLVS