RFC3

Replication factor C subunit 3

361 amino acids

May be involved in DNA replication and thus regulate cell proliferation.

Belongs to the activator 1 small subunits family.

39.626 kDa

MAGATAATPMDIDAAAPPPGAAAKGKAPLSSTPGGRAAPWVEKYRPQSLGDVAAHRDIVDTIDRLTNENRLPHLLLYGPPGTGKTSTILAVARKLYGSQYGNMILELNASDERGIDVVRQQIQDFASARSLSFGAKQSVKMVLLDEADAMTKDAQFALRRVIEKHTRSTRFALICNHVNKIIPALQSRCTRFRFAPLDGTHVRERLKHIIQSEGLDVDDGGLTALVRLSNGDMRKALNILQSTHMASKQITEEAVYLCTGNPMPKDIEQIAYWLLNESFSTSFKCISDMKMRKGLALVDIIREVTMFVFKIQMPSDVRIKLINDLADIEYRLSFACNDKLQLGALISTFTGARTAMVAAAH

RFC3

Replication factor C subunit 3

356 amino acids

The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1.

Belongs to the activator 1 small subunits family.

40.465 kDa

MSLWVDKYRPCSLGQLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETSSQKDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPPQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMIF

RFC3

Replication factor C subunit 3

356 amino acids

The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1.

Belongs to the activator 1 small subunits family.

40.556 kDa

MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF

Rfc3

Replication factor C subunit 3

356 amino acids

The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1.

Belongs to the activator 1 small subunits family.

40.526 kDa

MSLWVDKYRPSSLARLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGIGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETSSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICSVLSTVCRKEGLALPSTLARRLAEKSCRNLRKALLMCEACRVQQYPFTEDQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF

RFC3

Replication factor C subunit 3

354 amino acids

May be involved in DNA replication and thus regulate cell proliferation.

Belongs to the activator 1 small subunits family.

40.6 kDa

MLWVDKYRPKSLDKVIVHEDIAQKLKKLVSEQDCPHLLFYGPSGSGKKTLIMALLKQIYGASAEKVKVENRAWKVDAGSRTIDLELTTLSSTNHVELTPSDAGFQDRYIVQEIIKEMAKNRPIDTKGKKGYKVLVLNEVDKLSREAQHSLRRTMEKYSSSCRLILCCNSSSKVTEAIKSRCLNVRINAPSQEEIVKVLEFVAKKESLQLPQGFAARIAEKSNRSLRRAILSLETCRVQNYPFTGNQVISPMDWEEYVAEIATDMMKEQSPKKLFQVRGKVYELLVNCIPPEVILKRLLHELLKKLDSELKLEVCHWAAYYEHRMRLGQKAIFHIEAFVAKFMSIYKNFLISTFG

rfc3

Probable replication factor C subunit 3

347 amino acids

The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1.

Belongs to the activator 1 small subunits family.

39.551 kDa

MLWIDKYKPTSLDKMDYHNDISINLKNMIKSGDFPHLLVYGPSGAGKKTRILAVLQEIYGPNALKLKIDHRTFKHPTSSKNIQITTISSHYHIEINPGEAGSYDRVVIQTIIKEIAQSPPIDSGSLGAFKIVILNEVDKLSKDAQHALRRTMEKYATFCRLILCCDSTAKVIDPIKSRCLGIRVPAPSQEEIEKVLAKVATAEKFDLPSKLAVNVAKQSGGNLRYALMLLESQKAKQYPFQSTELPLLDWENYISQIVKDCFEEQSPARLSIVRGKLYELLGHCIPPELIFKTLLLEIFKKLDHNMKFEIIHWASYYEHRSQIGSKPIFHLEAFIAKFMSVYKKYNQ

rfc3

Replication factor C subunit 3

342 amino acids

The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. Subunit 3 binds ATP. Also involved in replication and DNA damage checkpoint controls, probably functioning as a checkpoint sensor.

Belongs to the activator 1 small subunits family.

38.44 kDa

MSIEKGKGRAMDIDLPLGSESTLPWVEKYRPANLEDVVSHKDIISTLEKFISSNRVPHMLFYGPPGTGKTSTILACARKIYGPNYRNQLMELNASDDRGIDAVREQIKNFASTRQIFASTFKMIILDEADAMTLAAQNALRRVIEKYTKNVRFCIICNYINKISPAIQSRCTRFRFQPLPPKEIEKTVDHVIQSEHCNIDPDAKMAVLRLSKGDMRKALNILQACHAAYDHIDVSAIYNCVGHPHPSDIDYFLKSIMNDEFVIAFNTISSIKQQKGLALQDILTCIFEALDELEIKPNAKIFILDQLATIEHRMSFGCSEKIQLSAMIASIKTGVDLAAKVN

RFC3

Replication factor C subunit 3

340 amino acids

Component of ATP-dependent clamp loader (RFC and RFC-like) complexes for DNA clamps, such as the POL30/PCNA homotrimer and the checkpoint clamp DDC1:MEC3:RAD17 complex. During a clamp loading circle, the RFC:clamp complex binds to DNA and the recognition of the double-stranded/single-stranded junction stimulates ATP hydrolysis by RFC. The complex presumably provides bipartite ATP sites in which one subunit supplies a catalytic site for hydrolysis of ATP bound to the neighboring subunit. Dissociation of RFC from the clamp leaves the clamp encircling DNA. Component of the replication factor C (RFC or activator 1) complex which loads POL30/PCNA and acts during elongation of primed DNA templates by DNA polymerase delta and epsilon. RFC has an essential but redundant activity in sister chromatid cohesion establishment. Component of the RFC-like complex CTF18-RFC which is required for efficient establishment of chromosome cohesion during S-phase and may load or unload POL30/PCNA. Component of the RFC-like RAD24-RFC complex which loads the checkpoint clamp DDC1:MEC3:RAD17 complex and is involved in DNA repair pathways. Component of the RFC-like ELG1-RFC complex which appears to have a role in DNA replication, replication fork re-start, recombination and repair. RFC3 supplies a catalytic site to the ATP site of RFC4.

Belongs to the activator 1 small subunits family.

38.204 kDa

MSTSTEKRSKENLPWVEKYRPETLDEVYGQNEVITTVRKFVDEGKLPHLLFYGPPGTGKTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQIFSKGFKLIILDEADAMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSRCTRFRFQPLPQEAIERRIANVLVHEKLKLSPNAEKALIELSNGDMRRVLNVLQSCKATLDNPDEDEISDDVIYECCGAPRPSDLKAVLKSILEDDWGTAHYTLNKVRSAKGLALIDLIEGIVKILEDYELQNEETRVHLLTKLADIEYSISKGGNDQIQGSAVIGAIKASFENETVKANV

RFC3

Replication factor C subunit 3

338 amino acids

The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1. Subunit 3 binds ATP (By similarity).

Belongs to the activator 1 small subunits family.

37.64 kDa

MDKGKKVETVEKQENSLPWVEKYRPTTLDEVAGHEGVITTIKKFVEEGKLPHLLFHGPPGTGKTTTIIAVARQIYGKNYRNMILELNASDERGIDVVRDQIKTFASTRQIFSSGFKLVILDEADAMTNAAQNALRRIIEKYSAHTRFCILANYTHKLNPALLSRCTRFRFSPLKEDAIKHRLAHVIEQESVDLSPEAFQSLLHLSSGDMRRALNVLQACYASVDAGEQISEELVYDCVGSPRPADIRTVLQAVLDGSWESALHTFSYIKQSKGLALADMLTAFAVEFQKLDLQNKTRIALLDGLSEIEWRLSSGGNESIQTSATIGVIKQSMELEASS