RBCS-3

Ribulose bisphosphate carboxylase small chain 3, chloroplastic

183 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.804 kDa

MATTMLNRSVIVNKEVAKTPNFPRATKNNKGFASNAAVQKCRDMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYILANSWTPCLEFAASDQAYAGNENCIRMGPVSSTYQDNRYWTMWKLPMFGCTDGSQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPPSATDYRLPADRQV

RBCS-3

Ribulose bisphosphate carboxylase small chain 3, chloroplastic

183 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.385 kDa

MASSLMSNAATTMAAATTTAQANMVAPFNGLKSVSAFPVTRKNNDITSVASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKPASYDA

RBCS-3

Ribulose bisphosphate carboxylase small chain 3, chloroplastic

182 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.571 kDa

MASIMMNKSVVLSKECAKPLASPKVTLNKRGFATTIATKNRGMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYILINSWTPCLEFAASDQAYAGNENCIRMGPVASTYQDNRYWTMWKLPMFGCTDASQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPPSATDYKLPADRQV

RBCS-3

Ribulose bisphosphate carboxylase small chain 3, chloroplastic

181 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.437 kDa

MASSIVSSAAVATRSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEGY