RBCS-2

Ribulose bisphosphate carboxylase small chain 2, chloroplastic

185 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site.

Belongs to the RuBisCO small chain family.

20.647 kDa

MAAVIAKSSVSAAVARPARSSVRPMAALKPAVKAAPVAAPAQANQMMVWTPVNNKMFETFSYLPPLSDEQIAAQVDYIVANGWIPCLEFAESDKAYVSNESAIRFGSVSCLYYDNRYWTMWKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNQKQVQIMGFLVQRPKSARDWQPANKRSV

RBCS-2

Ribulose bisphosphate carboxylase small chain 2, chloroplastic

180 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.084 kDa

MASMMSNAAVVGRTTPAQASMVAPFTGLKSVSAFPVTKKSNDITSIASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFTRIIGFDNVRQVQCISFIAYKPASYDA

RBCS-2

Ribulose bisphosphate carboxylase small chain 2, chloroplastic

173 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

19.665 kDa

single

VVLSKECAKPLATPKVTLNKRGFATTIATKNREMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYILTNSWTPCLEFAASDQAYAGNENCIRMGPVASTYQDNRYWTMWKLPMFGCTDGSQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPPSATDYRLPADRQV

RBCS-2

Ribulose bisphosphate carboxylase small chain 2

86 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

9.849 kDa

single

DNCIRMGPVSSTYQDNRYWTMWKLPMFGCTDGSQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPPSATDYRLPADRQV