RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

189 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

21.063 kDa

MASSILSSAAVASVNSASPAQASMVAPFTGLKSSAGFPITRKNNVDITTLASNAGKVQCMKVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGFYDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAFIRVIGFDNVRQVQCISFIAYKPQVLLFLSSIC

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

189 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

21.191 kDa

MASSIMALSSTAAVAAVAAPSKTGNSNVVSAFTGLKSMAQFPSSKTMSNAGAEWEQKTTSNGSRVRCMQVWPPYANKKFETLSYLPRLTPEQLVKEVEYLLKNKWVPCLEFEEDGEIKRVYGNSPGYYDGRYWVMWKLPMFGCTEASQVLNEVNECAKAYPNAFIRVIGFDNVRQVQCISFIVHKPEYN

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

187 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

21.199 kDa

MASSVMSTATVATGANAAQASMIASFNGLKSAASFPVTRKQDLDITSIASNGGRVECMLVWPPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEATKFSMFNV

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

183 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.527 kDa

MASSMISSGTVATVSADRPAPAQARMVAPFNGLKSSSAFPVTRKSNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAGF

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

183 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.721 kDa

MASSMLSTAAVACINRASPAQASMVAPFTGLKSTSAFPTTRKTTTDITSIASNGGRVQCMQVWPPRGKKFYETLSYLPPLTREQLAKEVEYLLRKGWVPCLEFELEHGTVYREYHRSPGYYDGRYWTMWKLPMFGCTDAVQVLQELDEMIKAYPDCYGRIIGFDNVRQVQCISFLAYKPKGAE

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

183 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.504 kDa

MASSMISSGTVATVSADRPAPAQARMVAPFTGLKSSSASPVTRKSNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAGF

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

182 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.535 kDa

MASSMISSATIATVNCSSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEELENCKKEYPNAFIRIIGFDNVRQVQCISFIAYKPKGY

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

181 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.227 kDa

MASSMLSSAAVVTSPAQATMVAPFTGLKSSSAFPVTRKANNDITSIVSNGGRVSCMKVWPPVGKKKFETLSYLPDLTEVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKPPSFTGA

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

181 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.324 kDa

MASSMLSSAAVVTSQLQATMVAPFTGLKSSAAFPVTRKTNTDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNALIRIIGFDNNRQVQCISFIAYKPPSFTDA

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

181 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.359 kDa

MASISSSAIATVNRTTSTQASLAAPFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALSKEIDYLIRNKWIPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEVGECKKEYPNAFIRVIGFDNIRQVQCISFIVAKPPGVL

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

180 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.311 kDa

MASSVLSSAAVATRSNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEGY

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

180 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate (PubMed:3681999). Both reactions occur simultaneously and in competition at the same active site.

Belongs to the RuBisCO small chain family.

20.311 kDa

MASSVLSSAAVATRSNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEGY

RBCS

Ribulose bisphosphate carboxylase small chain SSU11A, chloroplastic

180 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.335 kDa

MASSVMSSAAVATSTNAAQASMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYLPDLTDEQLLKEIEYLLNKGWVPCLEFETEHGFVYREYHASPRYYDGRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAWIRIIGFDNVRQVQCISFIAYKPPGY

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

180 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.156 kDa

MASSIMSSAAVATRSNGAQASMVAPFTGLKSNASFPVSRKTNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLSSEQLLSEIEYLLKNGWVPCLEFETEHGFVYREHTSSPGYYDGRYWTMWKLPMFGCTDATQVAAEVQEAKKAYPDAHIRIIGFDNVRQVQCISFIAYKPEAF

RBCS

Ribulose bisphosphate carboxylase small chain SSU8, chloroplastic

180 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.37 kDa

MASSVISSAAVATRTNVAQASMVAPFNGLKSAVSFPVSSKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYLPDLTDEQLLKEIEYLLNKGWVPCLEFETEHGFVYREYHASPRYYDGRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAWIRIIGFDNVRQVQCISFIAYKPPGF

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

180 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

19.869 kDa

MASVVASAAVVTPFAASAASTTKSSQIVSVQAGLKAGVFGGKSEWQTKTQTNGSRVSCMQVWEPYNNLKFETLSYLPPLSQDALAKQIDYVIKSGWAPCIEFDVQGTVTREGSTMPGYYDGRYWTMWKLPMFGCTDSASVLREIEECKKLYGKKCYIRCLGFDNTRQVQCASFIVHQPTL

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

178 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.018 kDa

MASSMISSPAVTTVNRAGAGTVAPFTGLKSMAGFPTRKTNNDIASIASNGGRVQCMQVWPTTGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNAFIRIIGFDNVRQVQCISFIAYKPPSF

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

178 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

19.949 kDa

MASSMISSPAVTTVNRAGAGTVAPFTGLKSMAGFPTRKTNNDIASIASNGGRVQCMQVWPTTGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPVFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPPSF

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

178 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.038 kDa

MALISSAAVTTINRAPVQANLATPFTGLKSSAGFPVTKKNNDITSITSNGSRVNCMQVWPPVGKKKFETLSYLPPLTDEQLLKEVEYLLRKGWVPCVEFELEKGFVHRQYNSSPGYYDGRYWTMWRLPLFGTTDAAQVLKEVAECKAEYPEAFIRIIGFDNVRQVQCISFIASTPKVY

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

178 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.317 kDa

MASSMMVSTAAVSRTSPAQSNMVVPFAGLHSSAAFPVTRKFADSSKLPSNGLRVRCMQVWPPEGKKKFETLSYLPPLTREQLGQEVDYLIRNGWIPCIEFCKVGFVYREYHNSPGYYDGRYWTMWKLPMFGCTDSSQVLKEVDECSKAYPDYFNRIIGFDNTRQVQCISFLTYKPEGN

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

178 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.211 kDa

MASISSSVATVSRTAPAQANMVAPFTGLKSNAAFPTTKKANDFSTLPSNGGRVQCMKVWPPLGLKKYETLSYLPPLTETQLAKEVDYLLRKKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELAECKKEYPQAWIRIIGFDNVRQVQCIMFIASRPDGY

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

177 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

19.698 kDa

MASLMSNAAVVTASTAAQANMVAPFSGLKSTSAFPVSRKSNVDITSLATNGGRVNCMQVWPPRNLKKFETLSYLPTLSEESLLKEINYLLIKGWVPCLEFEVGPAHVYRENNKSPGYYDGRYWTMWKLPMFGCTDASQVAAEVVECKNAYPDAHVRIIGFDNKRQVQCISFIAYKPE

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

175 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

19.647 kDa

MAPSVMASSATTVAPFQGLKSTAGMPVARRSGNSSFGNVSNGGRIRCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESGGN

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

175 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

19.647 kDa

MAPSVMASSATTVAPFQGLKSTAGMPVARRSGNSSFGNVSNGGRIRCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESGGN

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

175 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

20.11 kDa

MSFATTNKTIVPCATTKQIVRPRFLSNGTISKSRAMMVWEPFNNKFFETFSYLPPLTDDQITKQVDYILRNNWTPCLEFAGSDQAYVTHDNTVRMGDCASTYQDNRYWTMWKLPMFGCIDGSQVLTEISACTKAFPDAYIRLVCFDANRQVQISGFLVHRPESATDYRLPADRQV

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

175 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

19.517 kDa

MAPTVMASSATSVAPFQGLKSTAGLPVSRRSNGASLGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEGLLKQVDYLIRSKWVPCLEFRKVGFIFREHNVSPGYYDGRYWTMWKLPMFGCPAPTQVIPEVEEVRKEYPDPYCRIIGFDNMRQVQSVSFIASKPPGCEESGKA

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

173 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

19.546 kDa

MASIPATVAAVPQTNMVAPFTGLKANAAFPVTKKVNGFSTLPSNGGRVQCMKVWPPVGKKKYETLSYLPELTEAQLAKEVDYLLRNKWVPCLEFELEHGFVYRENASSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCVSFIASKPTGF

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

171 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

19.312 kDa

MATGAGAGAATVVSAFTGLKSTAQFPSSFKMSNAAAEWEQKTTSNGGRVRCMQVWPPFGNPKFETLSYLPTLTEEQLVKEVEYLLRNKWVPCLEFDLEGSISRKYNRSPGYYDGRYWVMWKLPMFGCTEASQVINEVRECAKAYPKAFIRVIGFDNVRQVQCISFIVHKPE

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

170 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

19.151 kDa

MAPTVMMASSATAVAPFQGLKSTASLPVARRSSRSLGNVSNGGRIRCMQVWPAYGNKKFETLSYLPPLSTDDLLKQVDYLLRNGWIPCLEFSKVGFVYRENSTSPCYYDGRYWTMWKLPMFGCNDATQVYKELQEAIKSYPDAFHRVIGFDNIKQTQCVSFIAYKPPGSD

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

168 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

18.908 kDa

MASIAAKSVSLRAATRRAAPVAAPADARFKVWQPVNNKQYETFSYLPPLTNQKIGRQVDYIINNGWTPCLEFADPSTSFVSNANAVRLQGVSAGYYDNRYWTMWKLPMFGCTDPSQVLREVSACQVAFPNVYIRLVAFDNVKQVQCMGFLVQRPRNAAEYCPLEKRSV

RBCS

Ribulose bisphosphate carboxylase small chain, chloroplastic

168 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

19.036 kDa

MALTVMASSATAAAPFQGLKSTASLPVARRSTTSLAKVSNGGRIRCMQVWPAYGNKKFETLSYLPPLTQEQLLKQVDYLLRNNWVPCLEFSKEGFVYRENSTSPCYYDGRYWTMWKLPMFGCTDASQVYKELQEAIASYPELRAILGFDNIRQTQWLTFIAYKPAGSE

rbcS

Ribulose bisphosphate carboxylase small chain

139 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

16.131 kDa

MKLTQGAFSFLPDLTDAQVTKQIQYALNKSWAISIEYTDDPHPRNSYWEMWGLPLFDVKDPAAILFEINMARKAKPNYYLKIACFDNTRGIESCVLSFIVQRPSYEPGFKMTRQEVKGRQLVYTLESYSVDAKPEGERY

rbcS

Ribulose bisphosphate carboxylase small chain

139 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.936 kDa

MRLTQGCFSFLPDLTDEQIEKQVNYAISKGWAMNVEWTDDPHPRNNYWELWGLPLFDIKDPASVMFELQEARKACAAGYIRMNAFDASYGTESCVMSFIVNRPANEPGFYLERAEGKGRQINYTIKSYSVQANPEGGRY

rbcS

Ribulose bisphosphate carboxylase small chain

139 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.813 kDa

MRLTQGCFSFLPDLTDEQIEKQVACAMSRGLAMNVEWTDDPHPRNNYWELWGLPLFDIKDPATVMFELNEARKSCAAGYIRMNAFDASYGTESCVMSFITNRPVSEPGFYLDRTEGVGRQIVYSIKSYSVQANPEGSRY

rbcS

Ribulose bisphosphate carboxylase small chain

139 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.938 kDa

MRVTQGCFSFLPDLSDDQIKQQVSYAMSKGWAVSVEWTDDPHPRNSYWELWGLPLFDVKDPAAVMYELAECRKVNPEGYIKINAFDASIGTESCVMSFIVQRPITEPGFYLERNEIHGRNIQYTISSYAVQARPSGDRY

rbcS

Ribulose bisphosphate carboxylase small chain

139 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.897 kDa

MRLTQGCFSFLPDLTDTQIEKQVAYAMNKGWAMNVEWTDDPHPRNNYWELWGLPLFDIKDPATVMFELNEARKSCASGYIRINAFDASYGVESCVMSFITNRPATEPGFYLDRTEGPGRQVIYSIKSYSVQANPEGSRY

rbcS

Ribulose bisphosphate carboxylase small chain

139 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

16.014 kDa

MRLTQGCFSFLPDLTDQQIEKQIAYCIDKGWAMNVEWTDDPHPRNSYWELWGLPLFDIKDIASVMFELSEARKSCANGYIRMNAFDASYGTESCVMSFIVSRPSNEPGFYLERTEGAGRFITYTIKRYSVQANAEGSRY

rbcS

Ribulose bisphosphate carboxylase small chain

139 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.897 kDa

MRVTQGCFSFLPDLSDEQIKLQVGYAMSKGWAVSVEWTDDPHPRNSYWELWGLPLFDVKDPAAVMYELAECRKVNPEGYIKINAFDASIGTESCVMSFIVQRPINEPGFYLERNEVQGRNIQYTISSYAVQARPSGDRY

rbcS

Ribulose bisphosphate carboxylase small chain

139 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.984 kDa

MRLTQGAFSFLPDLTDEQIVKQIQYAISKNWALNVEWTDDPHPRNAYWDLWGLPLFGIKDPAAVMFEINACRKAKPACYVKVNAFDNSRGVESCCLSFIVQRPTSNEPGFQLIRSEVDSRNIRYTIQSYASTRPEGERY

rbcS

Ribulose bisphosphate carboxylase small chain

139 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.958 kDa

MRLTQGAFSYLPDLTDAQIIKQIDYCLSRGWSVGVEWTDDPHPRNAYWELWGLPLFDVKDSSAILYEVNECRRLNPEGYIKLVAFNAARGTESSASAFIVQRPKSEPGFYLERTEAEGRMIRYTIHSYAVARNPEGSRY

rbcS

Ribulose bisphosphate carboxylase small chain

138 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

16.205 kDa

MRVTQGTFSFLPDLTNDQIRKQIQYAINKGWALSVEYTDDPHPRNSYWEMWGLPLFDVKDPAAIMFEVEACRKEKSNYYIKLLAFDSTKGVESTAMSFMVNRPAHEPGFVLRRIESNDRVQRYQIHSYATEKPEGERY

rbcS

Ribulose bisphosphate carboxylase small chain

138 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

16.225 kDa

MRVTQGTFCYLPDLTDEQIRKQIQYAINQGWAVSVEYTDDPHPRNSYWEMWGLPLFDVKDPATIMFEVQECRKQFPNHYIKVLAFNSTKGIESTALSFIVNRPANEPGFVLRRIESNDRVQRYQIHSYATEKPEGSRY

rbcS

Ribulose bisphosphate carboxylase small chain

138 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

16.206 kDa

MRITQGTFSFLPDLTDEQIKKQIDYMISKKLAIGIEYTNDIHPRNSFWEMWGLPLFEVTDPAPVLFEINACRKAKSNFYIKVVGFSSERGIESTIISFIVNRPKHEPGFNLIRQEDKSRSIKYSIQAYETYKPEDQRY

rbcS

Ribulose bisphosphate carboxylase small chain

138 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.95 kDa

MRLTQGTFSFLPDLTDEQISKQLTYIVSKGLSANVEYTDDPHPRNSYWELWGLPLFDVKDASAVMYEISSCRKAKPNYYIKVNAFDNTRGIESCVMSFIVNRPINEPGFLLQRQDFEGRTMKYSLHSYATEKPEGARY

rbcS

Ribulose bisphosphate carboxylase small chain

138 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.915 kDa

MRLTQGAFSFLPDLTDQQINKQLAYIVSKGWSANVEYTDDPHPRNAYWELWGLPLFDVKDPAAVMYEINSCRKAKPSYYVKVNAFDNTRGVESCSMSFIVNRPANEPGFLLQRQDFEGRTMKYTLHSYATEKPEGARY

rbcS

Ribulose bisphosphate carboxylase small chain

138 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.921 kDa

MRLTQGTFSFLPDLTDEQINKQLTYIVSKGLSANVEYTDDPHPRNSYWELWGLPLFDVKDASAVMYEISSCRKAKPNYYVKVNAFDNTRGIESCVMSFIVNRPANEPGFLLQRQDFEGRTMKYSLHSYATEKPEGARY

rbcS

Ribulose bisphosphate carboxylase small chain

138 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.949 kDa

MRVTQGTFSFLPDLTDEQINKQLAYIVSKGFSANVEYTDDPHPRNSYWELWGLPLFDVKDASAVMYEISSCRKAKPNYYIKVNAFDNTRGIESCVLSFIVNRPINEPGFLLQRQDFEGRTMKYSLHSYATEKPEGARY

rbcS

Ribulose bisphosphate carboxylase small chain

138 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.861 kDa

MRLTQGAFSFLPDLTDEQINKQLAYIVSKGLSANVEYTDDPHPRNSYWELWGLPLFDVKDASAVMYEISSCRKAKPNYYVKVNAFDNTRGIESCVMSFIVNRPANEPGFLLQRQDFEGRTMKYSLHSYATEKPEGARY

rbcS

Ribulose bisphosphate carboxylase small chain

138 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.891 kDa

MRLTQGTFSFLPDLTDEQINKQLAYIVSKGLSANVEYTDDPHPRNSYWELWGLPLFDVKDASAVMYEISSCRKAKPNYYVKVNAFDNTRGIESCVMSFIVNRPANEPGFLLQRQDFEGRTMKYSLHSYATEKPEGARY

rbcS

Ribulose bisphosphate carboxylase small chain

138 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

16.143 kDa

MRLTQGTFSFLPDLTDEQIKKQIAYAVSQNWAINIEFTDDPHPRNNYWELWGLPLFDINDVESVMYELESCRKQHSGLYIKINAFDNTRGVESCVLSFIINRPSYEPGFELIRSEDIGRNQKYSFRSYATAKPEGSRY

rbcS

Ribulose bisphosphate carboxylase small chain

138 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.959 kDa

MRLTQGTFSFLPDLTDAQIQKQVQYAVSKKWAVSVEYTDDPHPRNSFWELWGLPLFDVKDASALMYEIAACRKAKPNYYIKVNAFDNTRGVESCCLSFIINRPINEPGFHLERQEVQGRNILYTIKSYAVNKPEGSRY

RBCS

Ribulose bisphosphate carboxylase small chain

123 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site.

Belongs to the RuBisCO small chain family.

14.283 kDa

MQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPPLEFEVKDGFVYREHDKSPGYYDGRYWTMWKLPMFGGTDPAQVVNEVEEVKKAPPDAFVRFIGFNDKREVQCISFIAYKPAGY

rbcS

Ribulose bisphosphate carboxylase small chain

106 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

12.336 kDa

MQLRVERKFETFSYLPPLNDQQIARQLQYALSNGYSPAIEFSFTGKAEDLVWTLWKLPLFGAQSPEEVLSEIQACKQQFPNAYIRVVAFDSIRQVQTLMFLVYKPL

RBCS

Ribulose bisphosphate carboxylase small chain

82 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

9.603 kDa

single

ELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKPPSFTDA

RBCS

Ribulose bisphosphate carboxylase small chain

15 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

1.802 kDa

single

XQVWNPIGQPKFETF