About Products Protein Database Contact

RAN1

Gene
RAN1
Protein
Copper-transporting ATPase RAN1
Organism
Arabidopsis thaliana
Length
1001 amino acids
Function
Involved in copper import into the cell. Essential for ethylene signaling, which requires copper. Acts by delivering copper to create functional hormone receptors.
Similarity
Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IB subfamily.
Mass
107.395 kDa
Sequence
MAPSRRDLQLTPVTGGSSSQISDMEEVGLLDSYHNEANADDILTKIEEGRDVSGLRKIQVGVTGMTCAACSNSVEAALMNVNGVFKASVALLQNRADVVFDPNLVKEEDIKEAIEDAGFEAEILAEEQTQATLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALSTSLGEVEYDPNVINKDDIVNAIEDAGFEGSLVQSNQQDKLVLRVDGILNELDAQVLEGILTRLNGVRQFRLDRISGELEVVFDPEVVSSRSLVDGIEEDGFGKFKLRVMSPYERLSSKDTGEASNMFRRFISSLVLSIPLFFIQVICPHIALFDALLVWRCGPFMMGDWLKWALVSVIQFVIGKRFYVAAWRALRNGSTNMDVLVALGTSASYFYSVGALLYGAVTGFWSPTYFDASAMLITFVLLGKYLESLAKGKTSDAMKKLVQLTPATAILLTEGKGGKLVGEREIDALLIQPGDTLKVHPGAKIPADGVVVWGSSYVNESMVTGESVPVSKEVDSPVIGGTINMHGALHMKATKVGSDAVLSQIISLVETAQMSKAPIQKFADYVASIFVPVVITLALFTLVGWSIGGAVGAYPDEWLPENGTHFVFSLMFSISVVVIACPCALGLATPTAVMVATGVGATNGVLIKGGDALEKAHKVKYVIFDKTGTLTQGKATVTTTKVFSEMDRGEFLTLVASAEASSEHPLAKAIVAYARHFHFFDESTEDGETNNKDLQNSGWLLDTSDFSALPGKGIQCLVNEKMILVGNRKLMSENAINIPDHVEKFVEDLEESGKTGVIVAYNGKLVGVMGIADPLKREAALVVEGLLRMGVRPIMVTGDNWRTARAVAKEVGIEDVRAEVMPAGKADVIRSLQKDGSTVAMVGDGINDSPALAAADVGMAIGAGTDVAIEAADYVLMRNNLEDVITAIDLSRKTLTRIRLNYVFAMAYNVVSIPIAAGVFFPVLRVQLPPWAAGACMALSSVSVVCSSLLLRRYKKPRLTTVLKITTE

Gene
RAN1
Protein
Copper-transporting ATPase RAN1
Organism
Arabidopsis thaliana
Length
1001 amino acids
Function
Involved in copper import into the cell. Essential for ethylene signaling, which requires copper. Acts by delivering copper to create functional hormone receptors.
Similarity
Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IB subfamily.
Mass
107.395 kDa
Sequence
MAPSRRDLQLTPVTGGSSSQISDMEEVGLLDSYHNEANADDILTKIEEGRDVSGLRKIQVGVTGMTCAACSNSVEAALMNVNGVFKASVALLQNRADVVFDPNLVKEEDIKEAIEDAGFEAEILAEEQTQATLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALSTSLGEVEYDPNVINKDDIVNAIEDAGFEGSLVQSNQQDKLVLRVDGILNELDAQVLEGILTRLNGVRQFRLDRISGELEVVFDPEVVSSRSLVDGIEEDGFGKFKLRVMSPYERLSSKDTGEASNMFRRFISSLVLSIPLFFIQVICPHIALFDALLVWRCGPFMMGDWLKWALVSVIQFVIGKRFYVAAWRALRNGSTNMDVLVALGTSASYFYSVGALLYGAVTGFWSPTYFDASAMLITFVLLGKYLESLAKGKTSDAMKKLVQLTPATAILLTEGKGGKLVGEREIDALLIQPGDTLKVHPGAKIPADGVVVWGSSYVNESMVTGESVPVSKEVDSPVIGGTINMHGALHMKATKVGSDAVLSQIISLVETAQMSKAPIQKFADYVASIFVPVVITLALFTLVGWSIGGAVGAYPDEWLPENGTHFVFSLMFSISVVVIACPCALGLATPTAVMVATGVGATNGVLIKGGDALEKAHKVKYVIFDKTGTLTQGKATVTTTKVFSEMDRGEFLTLVASAEASSEHPLAKAIVAYARHFHFFDESTEDGETNNKDLQNSGWLLDTSDFSALPGKGIQCLVNEKMILVGNRKLMSENAINIPDHVEKFVEDLEESGKTGVIVAYNGKLVGVMGIADPLKREAALVVEGLLRMGVRPIMVTGDNWRTARAVAKEVGIEDVRAEVMPAGKADVIRSLQKDGSTVAMVGDGINDSPALAAADVGMAIGAGTDVAIEAADYVLMRNNLEDVITAIDLSRKTLTRIRLNYVFAMAYNVVSIPIAAGVFFPVLRVQLPPWAAGACMALSSVSVVCSSLLLRRYKKPRLTTVLKITTE

Gene
ran1
Protein
Negative regulator of sexual conjugation and meiosis
Organism
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
470 amino acids
Function
This protein is a negative regulator of both sexual conjugation and meiosis. It phosphorylates mei2. It blocks the onset of meiosis until conjugation takes place.
Similarity
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Mass
52.212 kDa
Sequence
MMRENPELLLGQVLGDSLRFVSIIGAGAYGVVYKAEDIYDGTLYAVKALCKDGLNEKQKKLQARELALHARVSSHPYIITLHRVLETEDAIYVVLQYCPNGDLFTYITEKKVYQGNSHLIKTVFLQLISAVEHCHSVGIYHRDLKPENIMVGNDVNTVYLADFGLATTEPYSSDFGCGSLFYMSPECQREVKKLSSLSDMLPVTPEPIESQSSSFATAPNDVWALGIILINLCCKRNPWKRACSQTDGTYRSYVHNPSTLLSILPISRELNSLLNRIFDRNPKTRITLPELSTLVSNCKNLTRRLRPAPLVSSRYLAYQQQQQQQQMNLQQGIQGYPHQGYMPTQNIGFPWPPTPQFVSNWNHCATPTIPVSLQVLTPNSSLKVDPTTPLTAPIHATESFWPSAAAAAAAVHNNANSYMPITPTPYPNNAKIFGYPNQPPLTPIPFTGFVLHPAPVGRAADAVDPSRKSL

Gene
RAN1
Protein
GTP-binding nuclear protein Ran-1
Organism
Arabidopsis thaliana
Length
221 amino acids
Function
GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle (By similarity).
Similarity
Belongs to the small GTPase superfamily. Ran family.
Mass
25.276 kDa
Sequence
MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFVETPALAPPEVHIDIADQQKNEAELLQAAAQPLPDDDDDIFE

Gene
RAN1
Protein
GTP-binding nuclear protein Ran-1
Organism
Oryza sativa subsp. indica
Length
221 amino acids
Function
GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle (By similarity).
Similarity
Belongs to the small GTPase superfamily. Ran family.
Mass
25.002 kDa
Sequence
MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEVSAKSNYNFEKPFLYLARKLAGDGNLHFVETPALAPPDVTIDLAAQQQHEAELAAAAAQPLPDDDDDLIE

Gene
RAN1
Protein
GTP-binding nuclear protein Ran-1
Organism
Oryza sativa subsp. japonica
Length
221 amino acids
Function
GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle (By similarity).
Similarity
Belongs to the small GTPase superfamily. Ran family.
Mass
25.002 kDa
Sequence
MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEVSAKSNYNFEKPFLYLARKLAGDGNLHFVETPALAPPDVTIDLAAQQQHEAELAAAAAQPLPDDDDDLIE

Gene
RAN1
Protein
GTP-binding nuclear protein Ran1
Organism
Solanum lycopersicum
Length
221 amino acids
Function
GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle (By similarity).
Similarity
Belongs to the small GTPase superfamily. Ran family.
Mass
25.186 kDa
Sequence
MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDGNLHFVESPALAPPEVHIDLAAQALHEEELQQAANQPLPDDDDEAFE