RAMP3

Receptor activity-modifying protein 3

151 amino acids

Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL (By similarity).

Belongs to the RAMP family.

17.368 kDa

MEATAPRRRHLLPLLLLLLLLCGECPPVSGCNEKRMLAMLPRCGKTFAEMMKKVEVWKWCNLSEFIVYYESFTNCTEVETNVVGCYWPNPLAQSFITGVHRRHFHNCSVDRQQWQDPPDEILIPLIVVPILLTLAMTGLVVWRSKRAAQVV

RAMP3

Receptor activity-modifying protein 3

148 amino acids

Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.

Belongs to the RAMP family.

16.518 kDa

METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL

Ramp3

Receptor activity-modifying protein 3

147 amino acids

Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.

Belongs to the RAMP family.

16.779 kDa

MKTPAQRLHLLPLLLLLCGECAQVCGCNETGMLERLPRCGKAFADMMQKVAVWKWCNLSEFIVYYESFTNCTEMETNIMGCYWPNPLAQSFITGIHRQFFSNCTVDRTHWEDPPDEVLIPLIAVPVVLTVAMAGLVVWRSKHTDRLL

Ramp3

Receptor activity-modifying protein 3

147 amino acids

Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.

Belongs to the RAMP family.

16.781 kDa

MATPAQRLHLLPLLLLLCGECAQVCGCNETGMLERLPRCGKAFAEMMQKVDVWKWCNLSEFIVYYESFTNCTEMETNIVGCYWPNPLAQSFITGIHRQFFSNCTVDRTHWEDPPDEVLIPLIAVPVLLTVAMAGLVVWRSKRTDRLL

RAMP3

Receptor activity-modifying protein 3

146 amino acids

Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL (By similarity).

Belongs to the RAMP family.

16.869 kDa

MGTRSRRPQLLWLLLLCGTCARVCGCNETRMLERLPRCGKTFAERMREVAVWKWCDLSQFIVFYESFTNCTEEETVVVGCYWPNPLAQGFITGVHRQFFSNCTVDRTHWEDPPDEVLIPLIAVPILLTVAMTGLVVWRSKRTDQLP