RAD51A

DNA repair protein RAD51 homolog A

340 amino acids

Binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. Unwinds duplex DNA (By similarity). Component of the meiotic recombination pathway. Seems to play a role in mediating chromosome homology search, chromosome pairing and synapsis at early stages and probably chromosome crossing-over at later stages in meiosis. Probably is involved in the repair of meiotic double strand breaks (DBSs) and in homologous recombination.

Belongs to the RecA family. RAD51 subfamily.

36.705 kDa

MSSAAQQQQKAAAAEQEEVEHGPFPIEQLQASGIAALDVKKLKDSGLHTVEAVAYTPRKDLLQIKGISEAKADKIIEAASKIVPLGFTSASQLHAQRLEIIQVTTGSRELDKILEGGIETGSITEIYGEFRSGKTQLCHTPCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMIETRFALMVVDSATALYRTDFSGRGELSARQMHMAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAMFAGPQFKPIGGNIMAHASTTRLALRKGRGEERICKVISSPCLAEAEARFQLASEGIADVKD

RAD51A

DNA repair protein RAD51 homolog 1

339 amino acids

Plays an important role in homologous strand exchange, a key step in DNA repair through homologous recombination. Binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. Catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template. Binds to single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange.

Belongs to the RecA family. RAD51 subfamily.

36.904 kDa

MAMQVQFEASTDTSAEEESFGPEPISRLEQCGINANDVKKLEEAGYHTVESVAHAPKKELLNIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKE