Rab7b

Ras-related protein Rab-7b

206 amino acids

Belongs to the small GTPase superfamily. Rab family.

23.291 kDa

MASQKKQLFKIIILGDSGVGKTSLMNQYVNARFTQQYRATVGADFMAKEVMIDDRMVTLQIWDTAGQERFQSLGGAFYRGADCCVLVYDITNPKSFDSLDSWRDEFLMQGQPKDPEHFPFVVLGNKLDKATERKVQESKSQQWCKSHGNIQFFEVSAKDATNIEQAFQDIAKAAASQEKDEEIFFPTTVTLTKQDPKKQTKQGGCC

RAB7B

Ras-related protein Rab-7b

200 amino acids

Controls vesicular trafficking from endosomes to the trans-Golgi network (TGN). Acts as a negative regulator of TLR9 signaling and can suppress TLR9-triggered TNFA, IL6, and IFNB production in macrophages by promoting TLR9 lysosomal degradation. Also negatively regulates TLR4 signaling in macrophages by promoting lysosomal degradation of TLR4. Promotes megakaryocytic differentiation by increasing NF-kappa-B-dependent IL6 production and subsequently enhancing the association of STAT3 with GATA1. Not involved in the regulation of the EGF- and EGFR degradation pathway (By similarity).

Belongs to the small GTPase superfamily. Rab family.

22.751 kDa

MNPRKKVDLKLIIIGALGVGKTSLLHRYVHKTFYEDYQTTLGASILSKIIILEDTTLKLQIWDTGGQERFRSMVSTFYKGSDGCVLAFDVTDLESFEALETWRGDVLAKTIPMEQPYPMVVLGNKIDLEDRQVPQEVAQGWCKEKDIPYFEVSAKNDINVVQAFEMLASRALSRYRSILESYLTDSIKLSPEDQPKSRCC

RAB7B

Ras-related protein Rab-7b

199 amino acids

Controls vesicular trafficking from endosomes to the trans-Golgi network (TGN). Acts as a negative regulator of TLR9 signaling and can suppress TLR9-triggered TNFA, IL6, and IFNB production in macrophages by promoting TLR9 lysosomal degradation. Also negatively regulates TLR4 signaling in macrophages by promoting lysosomal degradation of TLR4. Promotes megakaryocytic differentiation by increasing NF-kappa-B-dependent IL6 production and subsequently enhancing the association of STAT3 with GATA1. Not involved in the regulation of the EGF- and EGFR degradation pathway.

Belongs to the small GTPase superfamily. Rab family.

22.511 kDa

MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC

Rab7b

Ras-related protein Rab-7b

199 amino acids

Controls vesicular trafficking from endosomes to the trans-Golgi network (TGN). Acts as a negative regulator of TLR9 signaling and can suppress TLR9-triggered TNFA, IL6, and IFNB production in macrophages by promoting TLR9 lysosomal degradation. Also negatively regulates TLR4 signaling in macrophages by promoting lysosomal degradation of TLR4. Promotes megakaryocytic differentiation by increasing NF-kappa-B-dependent IL6 production and subsequently enhancing the association of STAT3 with GATA1. Not involved in the regulation of the EGF- and EGFR degradation pathway.

Belongs to the small GTPase superfamily. Rab family.

22.502 kDa

MNPRKKVDLKLIIVGALGVGKTSLLHQYVHKTFFEEYQTTLGASILSKIIILDDTTLKLQIWDTGGQERFRSMVSTFYKGSDGCILAFDVTDPESFEALDIWRDDVLAKIIPMEQSYPMVVLGNKIDLEDRKVSQEVVHGWCKEKDMPYFEVSAKNDINVVQAFEVLASRALLRYQGTAENHLIDSIKLSPGQPKSRCC

rab7B

Ras-related protein Rab-7B

197 amino acids

Protein transport. Probably involved in vesicular traffic (By similarity).

Belongs to the small GTPase superfamily. Rab family.

22.752 kDa

MTKGRKIIKVVIIGEKSVGKTSILRRYVDKRFVTLKPTIGVDFVMVSENMVTLQLWDTSGQERFRSLEISYYRGADYCILVFDVTNEKTLYDLKLWRDDFIEKTEIRDPILFPFIILGNKIDDPNRVVTEKAAIQWCKDNIGGNLTYFDTSAKDNINIEQVFKHISNQCENQPQSNEIPPEQLISLTEKKSNQSSCC