About Products Protein Database Contact

R01043

Gene
R01043
Protein
UPF0060 membrane protein R01043
Organism
Rhizobium meliloti (strain 1021)
Length
106 amino acids
Similarity
Belongs to the UPF0060 family.
Mass
11.311 kDa
Sequence
MPAYAIYFLAALAEITGCFAFWSWLRLGKSALWLIPGMASLALFAWLLTMVDAAAAGRTYAAYGGVYIVASLSWLWLAEGVRPDHWDMTGAAVALAGSAIILAGPR