POU1F1

Pituitary-specific positive transcription factor 1

370 amino acids

Transcription factor that activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.

Belongs to the POU transcription factor family. Class-1 subfamily.

41.191 kDa

MTCQAFASSDNFVPLNSDSSPSLPLIMHHSAAECLPVSNHATSVVSTVPSVLSLIQTPKCSHLHFAMMTSGNVSAGLHYSVPSCHYGNQTSTYGVMTGIKPATPEMLSASLSQSRILQTCSMPHPNVVNGVSTLQSKSFSFSCSLTPCLYKFPEHALSASSCALGHSFTPMHQTLLSDDPTAADFKQEFRRKSKSVEEPVDMDSPEIRELEKFANEFKLRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENSQLSFKNACKLKSILSKWLEEAEQVGALYNEKVGVNERKRKRRTTISIAAKEALERHFGEQSKPSSQEIMRMAEGLNLEKEVVRVWFCNRRQREKRVKTSLHQNAFSSIIKEHHECR

pou1f1

Pituitary-specific positive transcription factor 1

365 amino acids

Transcription factor that activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.

Belongs to the POU transcription factor family. Class-1 subfamily.

40.333 kDa

MSCQAFSADSFTTLAGDSLPLLMHHASAADCLPSSASTHTHNMVSAVPSGLSLLQSSKRSHMHLSTSTLGNGPPGLHYPVTPCHYSNQQTTYGMMAAQEMLSASISQTRILQTCSVPHPNMVNGANTLQGSLAPCLYKFPEHGLGGGSCSLSHSFPPLPPAVLSEEPPLGGTKDLRLRSRPPDDPPDMDSPQIRELEKFANNFKLRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACTLKAILAKWLDEAEQAGALFNEKMGMNERKRKRRTTISLGAKEALERSFREKIKPSSQEIVRMAEGLHLEKEVVRVWFCNRRQREKRVKTSLHHSSYLTKDSPTYRYPYLSPNAIKP

POU1F1

Pituitary-specific positive transcription factor 1

363 amino acids

Transcription factor that activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.

Belongs to the POU transcription factor family. Class-1 subfamily.

40.449 kDa

MTCQAFASSDNFVPLNSDSSPSLPLIMHHSAGECLPVSNHATNVVSTVPSVLSLIQTPKCSHFHFAMMTSGNVSAGLHYSVPSCHYGNQASTYGVMAGIKPATPEMLSASLSQSRILQTCSMPHPNVVNGVSTLQSSLTPCLYKFPEHALSASSCALGHSFTPMHQTLLSDDPTASDFKQEFRRKSKSVEEPVDMDSPEIRELEKFANEFKLRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKSILSKWLEEAEQVGALYNEKVGVNERKRKRRTTISISAKEALERHFGEQSKPSSQEIMRMAEGLNLEKEVVRVWFCNRRQREKRVKTSLHQNAFSSIIKEHHECR

pou1f1

Pituitary-specific positive transcription factor 1

358 amino acids

Transcription factor that activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.

Belongs to the POU transcription factor family. Class-1 subfamily.

39.376 kDa

MSCQAFSADSFTTLAGDSLPLLMHHASAADCLPSSASTHTHNMVSAVPSGLSLLQSSKRSHMHLSTSTLGNALSNGPPGLHYPVTPCHYSNQQTTYGMMAAQEMLSASISQTRILQTCSVPHPNMVNGANTLQGSLAPCLYKFPEHGLGGGSCSLSHSFPPLPPAVLSEEPPLGGTKDLRLRSRPPDDPPDMDSPQIRELEKFANDFKLRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACTLKAILAKWLDEAEQAGALFNEKMGMNERKRKRRTTISLGAKEALERSFGEKIKPSSQEIVRMAEGLHLEKEVVRVWFCNRRQREKRVKTSLHHSSYLTKDSPTYR

Pou1f1

Pituitary-specific positive transcription factor 1

291 amino acids

Transcription factor involved in the specification of the lactotrope, somatotrope, and thyrotrope phenotypes in the developing anterior pituitary. Activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.

Belongs to the POU transcription factor family. Class-1 subfamily.

32.885 kDa

MSCQSFTSADTFITLNSDASAALPLRMHHSAAECLPASNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPLHQPLLAEDPAASEFKQELRRKSKLVEEPIDMDSPEIRELEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISVAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR

POU1F1

Pituitary-specific positive transcription factor 1

291 amino acids

Transcription factor involved in the specification of the lactotrope, somatotrope, and thyrotrope phenotypes in the developing anterior pituitary. Activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.

Belongs to the POU transcription factor family. Class-1 subfamily.

33.033 kDa

MSCQPFTSADTFIPLNSESSATLPLIMHHSAAECLPASNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPMYQPLLPEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFPNEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEILRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFTISKEHLECR

Pou1f1

Pituitary-specific positive transcription factor 1

291 amino acids

Transcription factor involved in the specification of the lactotrope, somatotrope, and thyrotrope phenotypes in the developing anterior pituitary. Activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.

Belongs to the POU transcription factor family. Class-1 subfamily.

32.903 kDa

MSCQPFTSADTFIPLNSDASAALPLRMHHSAAEGLPASNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGTLTPCLYKFPDHTLSHGFPPLHQPLLAEDPTASEFKQELRRKSKLVEEPIDMDSPEIRELEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR

POU1F1

Pituitary-specific positive transcription factor 1

291 amino acids

Transcription factor involved in the specification of the lactotrope, somatotrope, and thyrotrope phenotypes in the developing anterior pituitary. Activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.

Belongs to the POU transcription factor family. Class-1 subfamily.

33.051 kDa

MSCQPFTSTDTFIPLNSESSATLPLIMHPSAAECLPVSNHATNVMSTATGLHYSVPSCHYGNQSSTYGVMAGSLTPCLYEFPDHTLSHGFPPMHQPLLSEDPTAADFKQELRRKSKLIEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILFKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEILRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFPNSKEHLECR

POU1F1

Pituitary-specific positive transcription factor 1

291 amino acids

Transcription factor involved in the specification of the lactotrope, somatotrope, and thyrotrope phenotypes in the developing anterior pituitary. Activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.

Belongs to the POU transcription factor family. Class-1 subfamily.

33.039 kDa

MSCQPFTSTDTFIPLNSESSATLPLIMHPSAAECLPVSNHATNVMSTATGLHYSVPFCHYGNQSSTYGVMAGSLTPCLYKFPDHTLSHGFPPMHQPLLSEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEILRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFTISKEHLECR

POU1F1

Pituitary-specific positive transcription factor 1

291 amino acids

Transcription factor involved in the specification of the lactotrope, somatotrope, and thyrotrope phenotypes in the developing anterior pituitary. Activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.

Belongs to the POU transcription factor family. Class-1 subfamily.

32.504 kDa

MSCQPFTSADTFLPLNSEASAALPLIMHPGAAECLPGSNHATNVVSTATGLHYSVPSCHYGNQPSTYGVMAGGLTPCLYKFPEHGLGPGFPAAHQPLLAEGPAVADFKQELRRRSKLAEEPVDTESPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFTISKEHLECR

POU1F1

Pituitary-specific positive transcription factor 1

291 amino acids

Transcription factor involved in the specification of the lactotrope, somatotrope, and thyrotrope phenotypes in the developing anterior pituitary. Specifically binds to the consensus sequence 5'-TAAAT-3'. Activates growth hormone and prolactin genes (PubMed:22010633, PubMed:26612202).

Belongs to the POU transcription factor family. Class-1 subfamily.

32.912 kDa

MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR

POU1F1

Pituitary-specific positive transcription factor 1

291 amino acids

Transcription factor involved in the specification of the lactotrope, somatotrope, and thyrotrope phenotypes in the developing anterior pituitary. Activates growth hormone and prolactin genes. Specifically binds to the consensus sequence 5'-TAAAT-3'.

Belongs to the POU transcription factor family. Class-1 subfamily.

32.959 kDa

MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGSLTLVFYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR