Pitx1

Pituitary homeobox 1

315 amino acids

Sequence-specific transcription factor that binds gene promoters and activates their transcription. May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb.

Belongs to the paired homeobox family. Bicoid subfamily.

34.207 kDa

MDAFKGGMSLERLPEGLRPPPPPPHDMGPSFHLARTADPREPLENSASESSDADLPDKERGGEAKVPEDGGAGSAGCGSAEDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGSVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS

Pitx1

Pituitary homeobox 1

315 amino acids

Sequence-specific transcription factor that binds gene promoters and activates their transcription. May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb. Can independently activate and synergize with PIT-1 on pituitary-specific target gene promoters, thus may subserve functions in generating both precursor and specific cell phenotypes in the anterior pituitary gland and in several other organs. Can activate pituitary transcription of the proopiomelanocortin gene.

Belongs to the paired homeobox family. Bicoid subfamily.

34.075 kDa

MDAFKGGMSLERLPEGLRPPPPPPHDMGPSFHLARAADPREPLENSASESSDADLPDKERGGEAKGPEDGGAGSAGCGGGAEDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS

PITX1

Pituitary homeobox 1

314 amino acids

Sequence-specific transcription factor that binds gene promoters and activates their transcription. May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb.

Belongs to the paired homeobox family. Bicoid subfamily.

34.128 kDa

MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS

PITX1

Pituitary homeobox 1

311 amino acids

Sequence-specific transcription factor that binds gene promoters and activates their transcription. May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb. Acts as a transcriptional activator by binding to promoter sequences with a TAAT/GCC core motif.

Belongs to the paired homeobox family. Bicoid subfamily.

34.473 kDa

MDSFKGGMNLERLPESLRPQPSHDMASSFHLQRSSEPRDPIENSASESSDTDVPEKERSESRKTREDGGAGSAGCTGAADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQMDLCKNGYVPQFSGLMQPYDDMYAGYPYNNWATKSLTPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMNMPSGMGHSAVPGMANSGLNNINNISGSSLNSAMSSPACPYGPPGSPYSVYRDTCNSSLASLALKSKQHSSFGYSSLQSPGSSLNACQYN

pitx1

Pituitary homeobox 1

305 amino acids

Sequence-specific transcription factor that binds gene promoters and activates their transcription. May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb.

Belongs to the paired homeobox family. Bicoid subfamily.

34.128 kDa

MDSFKGGMNLERLPESLRPQPSHDMATSFHLQRSSEARDPMDNSASESSDTEIAEKERTGEPKGEDGNGDDPSKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQMDLCKNGYVPQFSGLMQPYDEMYAGYPYNNWATKSLTPAPLSTKSFTFFNSMSPLSSQSMFSGPSSISSMSMPSSMGHSAVPGMANSSLNNINNLNNISGSSLNSAMSSTGCPYGPPGSPYTVYRDTCNSSLASLRLKSKQHSTFGYSSLQSPASSLNACQYNS