Pdcl3

Phosducin-like protein 3

240 amino acids

Acts as a chaperone for the angiogenic VEGF receptor KDR/VEGFR2, controlling its abundance and inhibiting its ubiquitination and degradation. Modulates the activation of caspases during apoptosis (By similarity).

Belongs to the phosducin family.

27.699 kDa

MQDPNADTEWNDILRKKGILPPKESLKELEEEEEGKEEQRLQQSVVKTYEDMTLEELQENEDEFSEEDERAIEMYRQQRLAEWKATQLRNKFGEVLEISGKDYVQEVTKAGEGLWVVLHLYKQGIPLCSLINHHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTVFVYREGDIKAQFIGPLVFGGMNLTIDELEWKLSESGAIKTELEENPKKAIKDVLLSSVRDPVPMRRDSDSEDD

PDCL3

Phosducin-like protein 3

240 amino acids

Acts as a chaperone for the angiogenic VEGF receptor KDR/VEGFR2, controlling its abundance and inhibiting its ubiquitination and degradation. Modulates the activation of caspases during apoptosis (By similarity).

Belongs to the phosducin family.

27.479 kDa

MQDPNADTEWNDILRKKGILPSKEDLKDLEKEAEEEEQRILQQSIVKTYEDMTLEELEDNEDEFNEEDERAIEMYRQQRLAEWKATQLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSALARKFPDVKFIKAISTTCIPSYPDRNLPTVFVYLEGDIKAQFIGPLVFGGMNLTLDELEWKLSESGAIKTSLEENPKKPVEDVLLSAVRCSVPAKRDSDSEDD

Pdcl3

Phosducin-like protein 3

240 amino acids

Acts as a chaperone for the angiogenic VEGF receptor KDR/VEGFR2, controlling its abundance and inhibiting its ubiquitination and degradation. Modulates the activation of caspases during apoptosis (By similarity).

Belongs to the phosducin family.

27.581 kDa

MQDPNADTEWNDILRKKGILPPKESLKELEEEEAEKEEQLLQQSVVKTYEDMTLEELEENEDEFSEEDERAIEMYRQQRLAEWKATQLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCSLINHHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTVFVYREGDIKAQFIGPLVFGGMNLTIDELEWKLSESGAIKTALEENPKKPIQDLLLSSVRGPVPMRRDSDSEDD

pdcl3

Phosducin-like protein 3

239 amino acids

Acts as a chaperone for the angiogenic VEGF receptor KDR/VEGFR2, controlling its abundance and inhibiting its ubiquitination and degradation. Modulates the activation of caspases during apoptosis (By similarity).

Belongs to the phosducin family.

27.657 kDa

MQDPNADTEWNDILRKKGILPPKETPVEEEEDEQLHLQSQSVVKTYEDMTLEELEENEDEFSEEDEHAMEMYRLKRLAEWKANQMKNVFGELKEISGQDYVQEVNKAGEGIWVVLHLYKQGIPLCSLINQHLAQLARKFPQSKFLKSISSTCIPNYPDRNLPTLFVYRDGEMKAQFIGPLVFGGMNLTCDELEWRLSESGAVKTDLEENPRKQIQDQLMTSIRCSANTHRDGEEDSDED

PDCL3

Phosducin-like protein 3

239 amino acids

Acts as a chaperone for the angiogenic VEGF receptor KDR/VEGFR2, controlling its abundance and inhibiting its ubiquitination and degradation. Modulates the activation of caspases during apoptosis. Is a substrate for Orgyia pseudotsugata multicapsid polyhedrosis virus (OpMNPV) IAP-mediated ubiquitination.

Belongs to the phosducin family.

27.614 kDa

MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERAIEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD

PDCL3

Phosducin-like protein 3

239 amino acids

Acts as a chaperone for the angiogenic VEGF receptor KDR/VEGFR2, controlling its abundance and inhibiting its ubiquitination and degradation. Modulates the activation of caspases during apoptosis (By similarity).

Belongs to the phosducin family.

27.572 kDa

MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELDDHEDEFNEEDERAIEMYRRQRLAEWKVTKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSALMKRDSDSEGD