papD

Chaperone protein PapD

239 amino acids

Binds and caps interactive surfaces on P pilus subunits to prevent them from participating in non-productive interactions. Facilitates the import of P pilus subunits into the periplasm, probably also facilitates their folding (PubMed:9351822). Chaperone-subunit complexes are then targeted to the PapC outer membrane usher where the chaperone must uncap from the subunits. Coexpression of this chaperone with individual, otherwise toxic, P pilus subunits (tested with PapA, PapE and PapG) suppresses their growth inhibitory phenotype (PubMed:9351822).

Belongs to the periplasmic pilus chaperone family.

26.803 kDa

MIRKKILMAAIPLFVISGADAAVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKKEK

PapD

Male accessory gland serine protease inhibitor

63 amino acids

Serine protease inhibitor. This peptide can inhibit, in-vivo, acrosin and, to a lower level, plasma kallikrein. It probably plays a role in Drosophila reproduction.

6.911 kDa

FKNPECGEPHSLDGSPNGISCRGYFPSWSYNPDAQQCVSFVYGGCGGNNNRFGSQNECEERCI