PSRP2

30S ribosomal protein 2, chloroplastic

260 amino acids

Component of the chloroplast ribosome (chloro-ribosome), a dedicated translation machinery responsible for the synthesis of chloroplast genome-encoded proteins, including proteins of the transcription and translation machinery and components of the photosynthetic apparatus (PubMed:10874039, PubMed:28007896). cS22 may have a role in the recruitment of stored chloroplast mRNAs for active protein synthesis (PubMed:12605670).

Belongs to the chloroplast-specific ribosomal protein cS22 family.

28.293 kDa

MATISSILPCHGLLQHCSSSSSSSKPKFSSQNLVQLQSFSNGFGLKLKTRVSTNPPLLKVRAVVTEETSSSSTASSSSDGEGARRLYVGNIPRNLNNDELRTIVEEHGAIEIAEVMYDKYSGRSRRFGFVTMKTVEDANAVIEKLNDTEIGGRKIKVNITEKPLEGMDIATTQAEDSQFVESPYKVYIGNLAKTVTNELLKDFFSEKGKVLGAKVQRTPGTSKSNGFGFVSFSSEEEVEAAIQALNNSVLEGQKIRVNKA

PSRP2

30S ribosomal protein 2, chloroplastic

253 amino acids

Component of the chloroplast ribosome (chloro-ribosome), a dedicated translation machinery responsible for the synthesis of chloroplast genome-encoded proteins, including proteins of the transcription and translation machinery and components of the photosynthetic apparatus. May have a role in the recruitment of stored chloroplast mRNAs for active protein synthesis (By similarity). Bind single strand DNA (ssDNA) and RNA in vitro. Exhibits RNA chaperone activity. Regulates negatively resistance responses to abiotic stresses during seed germination (e.g. salt, dehydration, and low temperature) and seedling growth (e.g. salt) (PubMed:24220572).

Belongs to the chloroplast-specific ribosomal protein cS22 family.

27.748 kDa

MATFLTNVVSIKPTIFSFQSESFTPLHTRVNVFSSKPFPSLAGTFSRSSRTRFIPYAVTETEEKPAALDPSSEAARRVYIGNIPRTVTNEQLTKLVEEHGAVEKVQVMYDKYSGRSRRFGFATMKSVEDANAVVEKLNGNTVEGREIKVNITEKPIASSPDLSVLQSEDSAFVDSPYKVYVGNLAKTVTKEMLENLFSEKGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRVNKA