PSMG1

Proteasome assembly chaperone 1

290 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization (By similarity).

Belongs to the PSMG1 family.

33.053 kDa

MAATFFGEVVKAPCRAGTEDEEEEEEEEGRRETPEDREVRQQLARKREVRLLRRQTKTSLEVSLLEKYPCSKFIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTADTTHLSSTEAFCGFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTLESTGSLPSPFLKALKTQNFKDPACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNISQSTEILKKLMTTNEIQSNIYT

Psmg1

Proteasome assembly chaperone 1

289 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization (By similarity).

Belongs to the PSMG1 family.

33.104 kDa

MAATFFGEVVKAPCRAGTEEEEEEEEQSRRDTPEDREVRRQLARKREVRLLRRQTETSLEAVLLETHPCSKFIIAVGSNATAFLSAFVMNSGVWEEVGCAKLWNEWCRTTDTVRLSPTDVFCVFYQLKSDPSVFLCQCSCYIAEDQQFQWLEKVFGFQPRKSMQVTVLTCRHITDYKTPESTCSLSSPFLRALKTQTFKDALCCPLLEQPNIVHDLSAAVLSYCQVWKIPAVLYLCYTDVMKLDRVTVEAFKPLLSSRSLKCLVKNIPESTEILKKLMTTNEIQSNIYT

PSMG1

Proteasome assembly chaperone 1

288 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization (By similarity).

Belongs to the PSMG1 family.

33.015 kDa

MAATFFGEVVRTPCRAGTEEEEEEEDGNRETPEDREVRRQLARKREVRLFRRQTKTTLEVSLLEKHPCSKFIIAIGNNAVAFLSSFVMNSGAWEEVGCAKLWNEWCRTTDTAHLSPTEAFCVFYHLKSNPSVMLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQVTILTCRHVTDYKTSESTSSLHTPFLKALKTQNFKEPPFCSLLEQPNIVHDLPAAVLSYCQVWRIPAVLYLCYTDVMKLDLITIEAFKPVLSSKSLKCLVKNIPQSTEILKKLMTTNEIQSNIYT

PSMG1

Proteasome assembly chaperone 1

288 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization (By similarity).

Belongs to the PSMG1 family.

32.849 kDa

MAATFFGEVVKAPCRAGTEDEEEEDEGRRETPEDREVRQQLARKREVRLLRRQTKTSLEVSLLEKYPCSKFIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTTDTIHLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLKALKTQNFKDPACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPLLSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT

PSMG1

Proteasome assembly chaperone 1

288 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.

Belongs to the PSMG1 family.

32.854 kDa

MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARKREVRLLRRQTKTSLEVSLLEKYPCSKFIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT

psmg1

Proteasome assembly chaperone 1

288 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with psmg2.

Belongs to the PSMG1 family.

32.147 kDa

MATFFGEVQSVFSRAVDEEEEDEDDDEEEEEDREIIAELERKREVRVTWNPELTAAIESSPGKRLPCSSVILSVGDNATGFVSSYILSSGSWEVAGSVTLWNERCRDCNVRKDFLPAPSSCTFYRSITDPTVLLCQCNCHVAEDQLFQWCEKVFGSLEKSSLKVTVLSTCPVSEYKTPESTYSLPVPFLKALRTSEYREEVPCPLLEQPNIVDGLPAAVLSHCQVLGIPAVFYQCYTDISKLDSVTIKAFRPLLSSGSLSRLAADSANIQETLRKTVKLNEIQSNLYI

psmg1

Proteasome assembly chaperone 1

287 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with psmg2.

Belongs to the PSMG1 family.

32.367 kDa

MATFFGEVQSVFSRAVDEDDEEEEGEEEEEDREIIAELERKREVHVTWNPEVTAAIESSPNRRLPCSNVILSVGDNATGFVSSYILSSGSWEVCGSITLWNERCRDCNPRKDSLPAPSSCTFYRSITDPTVLLCQCNSYIAEDQLFQWCEKVFGSLEKSSLNVTVLSTCPVSEYKTPESTYSLPVPFLKALRTSEYREEVPCPLLEQPNIADGLPAAVLTYCQVWQIPAVFYRCYTDLSKLDSITIDAFRPLLSCQRMSRLAADSAKIQETLRKTVKSSEIQSNLYI

psmg1

Proteasome assembly chaperone 1

277 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with psmg2.

Belongs to the PSMG1 family.

30.727 kDa

MATFFGEVLSVYSRAVEEDEYEDMTNENEEDEQIRREIEEKRSVEVCWLLGSQDGPLQCSDLIIGAGPNASGFIRAYLLSTVGWTAVAWLSFWNERSRGSERPTVVPGPGEPSCVLYRLESCPTVLICQCQGFVAEDQLFQFTEKVFSCVQTRDLNVTILSDCSSADYKTSDYLSGSSTPFLRCLKTSTYTHTVTCPPLEQPNICSGLAAAVLSHCQVHQISAVLYQCYSDVLHPDSASMQMFAATLSSVLKLEQSLSADVLQRVTRVSEIQSNLYT

psmG1

Proteasome assembly chaperone 1

272 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with psmg2.

Belongs to the PSMG1 family.

31.344 kDa

MFGFEIQPVRSRNWEIEEEEDQEVVSVEIPKPSISFVNDNYKLEFNNNNDTPFNIIVSTNGSPSIFVKGCFESNQFDEIADISYSDIKPLKTTNTNTVLNNKCTVYRHKIEKSMIFITVQYDLPSERCFGFTELVLNTFKNVSQVLVLDKILNTHYLSQNYTHPIPPFTRAIFNSLFKNDYSLTPLESSNIIENLSASFLTICQVKYIPACSILNLYESHLNIESVQSFTPIVKSIYPQLFNNSSLKQEDITSQFKLMINALNKRNDKGMYM

psmg1

Proteasome assembly chaperone 1

257 amino acids

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with psmg2.

Belongs to the PSMG1 family.

28.785 kDa

MVDAFGLWELNFPCSRVDDDDDEEEQITKEQEEQLCPQFVFSPQFSKDVGKTEPIECSVLVLGVGEVASTFLEVHFLCGNNSSVAAVISDKKTEKNFEYLVKNLRNKRSSLLHQLTRNNDVMVCQISSHVEQDKGFYWTQKIFSHIRPAKVVILTSSPASEYNSDDPSEIKTDFVKMMKTNAWSNSCAGPDITDIQTPNTVKGLAASVLTHCQIYKLPAALFMCYTESMHVDAQAVEAFRCKAPYKQSSMGLESGKL