PSMD12

26S proteasome non-ATPase regulatory subunit 12

456 amino acids

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair.

Belongs to the proteasome subunit p55 family.

53.053 kDa

MADGGSERADGRIVKMEVDYSATVDQRLPECEKLAKEGRLQEVIETLLSLEKQTRTASDMVSTSRILVAIVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPIKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTEKLKLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGYTEEGEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ

PSMD12

26S proteasome non-ATPase regulatory subunit 12

456 amino acids

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair.

Belongs to the proteasome subunit p55 family.

52.904 kDa

MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSLEKQTRTASDMVSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPIKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTEKLKLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ

Psmd12

26S proteasome non-ATPase regulatory subunit 12

456 amino acids

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair.

Belongs to the proteasome subunit p55 family.

52.895 kDa

MADGGSERADGRIVKMEVDYSATVDQRLPECEKLAKEGRLQEVIETLLSLEKQTRTASDMVSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPVKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTENLKLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESDKWQQALKSVVLYVILAPFDNEQSDLVHRISSDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGVELRKGSSETPATDVFSSTEEGEKRWKDLKSRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGVINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ

PSMD12

26S proteasome non-ATPase regulatory subunit 12

456 amino acids

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair.

Belongs to the proteasome subunit p55 family.

52.93 kDa

MADGGSERADGRIVKMEVDYSPTVDQRLPECAKLAKEGRLQEVIETLLSLEKQTRTASDMVSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPIKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTEKLKLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ

psmD12

26S proteasome non-ATPase regulatory subunit 12

447 amino acids

Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.

Belongs to the proteasome subunit p55 family.

51.592 kDa

MTIGLEPAVSSKTKDKMEQDLSPIADKSCKENRELAKSGKLIEAIENLLITEKQCRQAEDSPSTSKIAAEIIKLCYEAGRLDLVNEKLVLLSKRRGQLRPAIKAIVQESMVYVDQITDMKQKLELIDTLRTISDGKIFVENERARLTKTLSKIKEDEGDIASAAKILQDLQVETYGTMEKREKITFFIDQMRICMNNKDFIRAQLIGNKVNRKTLAEDENQDLKIDYFKQMIRYFSHSANYIEIARCYLSIYDTPSVEKDTPQLLQTLKYICIYVILSASSNEQSDLLNRVYEFKPLTDIQNYKDLLNQFKTLELIRWSTFFELNKPELDSQTVFKTEPNAWEDLRKRVIEHNIRVISTYYQKISTARLAELLDLSLDESEKFVSDLVSNKTIFAKIDRPAGIATFTTTNDPNKVLNAWANNITSLLDLVEKTNHLVQREFMLHKIN