PSBS

Photosystem II 22 kDa protein, chloroplastic

276 amino acids

Seems to be involved in non-photochemical quenching, a process maintains the balance between dissipation and utilization of light energy to minimize generation of oxidizing molecules, thereby protecting the plant against photo-oxidative damage.

Belongs to the ELIP/psbS family.

29.268 kDa

MAQTMLLTANAKVDLRSKESLVERLKPKPLSSLFLPSLPLRFSSSSTNASSSKFTSTTVALFKSKAKAPPKKVAPPKEKQKVEDGIFGTSGGIGFTKQNELFVGRVAMIGFAASLLGEAITGKGILAQLNLETGIPIYEAEPLLLFFILFNLLGAIGALGDRGKFVDDPTPPTGLEKAVIPPGKSFKSALGLSEGGPLFGFTKANELFVGRLAQLGIAFSIIGEIITGKGALAQLNFETGVPINEIEPLLLFNIAFFFFAAINPGTGKFITDEEED

PSBS

Photosystem II 22 kDa protein, chloroplastic

276 amino acids

Seems to be involved in non-photochemical quenching, a process maintains the balance between dissipation and utilization of light energy to minimize generation of oxidizing molecules, thereby protecting the plant against photo-oxidative damage.

Belongs to the ELIP/psbS family.

29.344 kDa

MAQTMLLTANAKVDLRSKESLVERLKPKPLSSLFLPSLPLRFSSSTTNFSSSKFTSTTVALFKSKAKAPPKKVAPPKEKQKVEDGIFGTSGGIGFTKQNELFVGRVAMIGFAASLLGEAITGKGILAQLNLETGIPIYEAEPLLLFFILFNLLGAIGALGDRGRFIDDPAPATGLEKAVIPPGKSFKSALGLSEGGPLFGFTKANELFVGRLAQLGIAFSIIGEIITGKGALAQLNFETGVPINEIEPLLLFNIAFFFFAAINPGTGKFITDEEED

PSBS

Photosystem II 22 kDa protein, chloroplastic

274 amino acids

Seems to be involved in non-photochemical quenching, a process maintains the balance between dissipation and utilization of light energy to minimize generation of oxidizing molecules, thereby protecting the plant against photo-oxidative damage.

Belongs to the ELIP/psbS family.

29.197 kDa

MAQAMLLMMPGVSTTNTIDLKRNALLKLQIQKIKPKSSTSNLFFSPLPSSSSSSSTVFKTLALFKSKAKAPKKVEKPKLKVEDGLFGTSGGIGFTKENELFVGRVAMIGFAASLLGEGITGKGILSQLNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGRFVDEPTTGLEKAVIPPGKDVRSALGLKTKGPLFGFTKSNELFVGRLAQLGFAFSLIGEIITGKGALAQLNIETGVPINEIEPLVLLNVVFFFIAAINPGTGKFITDDEEED

PSBS

Photosystem II 22 kDa protein, chloroplastic

274 amino acids

Seems to be involved in non-photochemical quenching, a process maintains the balance between dissipation and utilization of light energy to minimize generation of oxidizing molecules, thereby protecting the plant against photo-oxidative damage.

Belongs to the ELIP/psbS family.

29.087 kDa

MAQTMLLTANAKVDLRSKESLVERLKPKPLSSFFLPSLPLKYPSASASASSHFTSTTVALFKSKAKAPAKKVVPKPKEKVEDGIFGTSGGIGFTKQNELFVGRVAMIGFAASLLGEAITGKGILAQLNLETGIPIYEAEPLLLFFILFNLLGAIGALEDRGKFIDDPAPPTGLDKAVIPPGKGFKSALGLSEGGPLFEFTKANELFVGRLAQLGIAFSIIGEIITGKGALAQLNFETGVPINEIEPLLLFNIVFFFVAAINPGTGKFVTDEEEE

PSBS

Photosystem II 22 kDa protein, chloroplastic

265 amino acids

Plays an important role in non-photochemical quenching, a process maintains the balance between dissipation and utilization of light energy to minimize generation of oxidizing molecules, thereby protecting the plant against photo-oxidative damage. Is not necessary for efficient light harvesting and photosynthesis.

Belongs to the ELIP/psbS family.

28.008 kDa

MAQTMLLTSGVTAGHFLRNKSPLAQPKVHHLFLSGNSPVALPSRRQSFVPLALFKPKTKAAPKKVEKPKSKVEDGIFGTSGGIGFTKANELFVGRVAMIGFAASLLGEALTGKGILAQLNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGKFVDDPPTGLEKAVIPPGKNVRSALGLKEQGPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKGALAQLNIETGIPIQDIEPLVLLNVAFFFFAAINPGNGKFITDDGEES