PRE7

Probable proteasome subunit beta type-6

290 amino acids

The proteasome degrades poly-ubiquitinated proteins in the cytoplasm and in the nucleus. It is essential for the regulated turnover of proteins and for the removal of misfolded proteins. The proteasome is a multicatalytic proteinase complex that is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. It has an ATP-dependent proteolytic activity (By similarity).

Belongs to the peptidase T1B family.

32.454 kDa

MLSNKRGIHSASGGIDLRTLREYCLFEDFDVCMPFNPMGVPGGKGNRGSDGAIRGMLPLGDAMGDLFTAGKAGSTKMEDKERFDPYEDNSGTTICLKQGDFIVVAGDTRHSSSMVINSREMSKIFQVGDFLLTGTGFYADTHEVYVKMVYEIRQYEVDDSINIHSAANLLSKILYSKRFFPYYSFCVLSGFEKGKPYVYSYDPIGSFGSVTCVCSGSGRSMIQPLLDSFIDKKNWNNAEETQLSQEDCIRLVVKAFNSAAERDVKTKDNLEVCVMRENQVMRETFPLRRD

PRE7

Proteasome subunit beta type-6

241 amino acids

The proteasome degrades poly-ubiquitinated proteins in the cytoplasm and in the nucleus. It is essential for the regulated turnover of proteins and for the removal of misfolded proteins. The proteasome is a multicatalytic proteinase complex that is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. It has an ATP-dependent proteolytic activity.

Belongs to the peptidase T1B family.

26.871 kDa

MATIASEYSSEASNTPIEHQFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD