pre6

Probable proteasome subunit alpha type-4

259 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity).

Belongs to the peptidase T1A family.

28.277 kDa

MSGYDRALSVFSPDGRLLQVEYGQEAVRRGTTAIALRGNECIVIGVERKNVPKLQNVSNFQKIAMVDNHVCLAFAGLNADARILIDKARVEAQNHKLNLADPVSIEYLTRYVAGVQQKYTQSGGVRPFGVSTLIAGFDVGDNTPRVYQTEPAGIYNAWKATAIGRASKAAREYLEKNWKEGLSRDETIHLAVSSLLEVVQTASGNIELAIMDPGKDVEFLHSDKIDTIVKEIQDEKEAEAARKKSGRSAPGVSTTSTIQ

PRE6

Proteasome subunit alpha type-4

254 amino acids

The proteasome degrades poly-ubiquitinated proteins in the cytoplasm and in the nucleus. It is essential for the regulated turnover of proteins and for the removal of misfolded proteins. The proteasome is a multicatalytic proteinase complex that is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. It has an ATP-dependent proteolytic activity.

Belongs to the peptidase T1A family.

28.439 kDa

MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQQEQDKKKKSNH

PRE6

Transcription factor PRE6

94 amino acids

Atypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex.

Belongs to the bHLH protein family.

10.718 kDa

MSSRRSSRSRQSGSSRISDDQISDLVSKLQHLIPELRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLASTDDNSAEAAIIRSLLNY