pre3

Probable proteasome subunit beta type-1

226 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity).

Belongs to the peptidase T1B family.

24.564 kDa

MATTVKDTMNVDINAIKKGEIRMGTTITALRYKDGVILAADSRTTMGAYIANRVTDKLTQLTDNIWCCRSGSAADTQTVADLLKYYLSMYRIQFGHDPSVHTAATLASEMCYQNKNMLSAGLIVAGYDEKTGGDVYSIPLGGSLHKQPLAIGGSGSAFIYGFCDANFRENMTQEEAVEFLKNAVALAMERDGSSGGTIRMVILNKDGMERKFFAIDTANPIPVFTH

PRE3

Proteasome subunit beta type-1

215 amino acids

This subunit is necessary for the peptidylglutamyl-peptide hydrolyzing activity.

Belongs to the peptidase T1B family.

23.548 kDa

MNGIQVDINRLKKGEVSLGTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL

PRE3

Probable proteasome subunit beta type-1

203 amino acids

The proteasome degrades poly-ubiquitinated proteins in the cytoplasm and in the nucleus. It is essential for the regulated turnover of proteins and for the removal of misfolded proteins. The proteasome is a multicatalytic proteinase complex that is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. It has an ATP-dependent proteolytic activity (By similarity).

Belongs to the peptidase T1B family.

22.189 kDa

MMSNEKEMTGTTIIAIKYDDGVLIGADSRTSMGAYVSSRVTDKLTQITDKIFVCRSGSSADTQMISSYLRMYLSMYSQLEDSIPQVQRAAALASKIIYENPSLLAGLIVAGYDDKPRVFNISLGGSLTERDWAIGGSGSAFIYGYCDVNWRSGMSLEEGIRFVRNAVSCAINRDNASGGCIRMSAISRTGVQRYFYPGDKVLQ

PRE3

Transcription factor PRE3

93 amino acids

Atypical and probable non DNA-binding bHLH transcription factor required for MONOPTEROS-dependent root initiation in embryo. Promotes the correct definition of the hypophysis cell division plane. Transcriptionally controlled by MONOPTEROS. Moves from its site of synthesis in pro-embryos cells into the hypophysis. Regulates brassinosteroid (BR) signaling by sequestering negative BR signaling components. May function as positive regulator of gibberellin signaling. May play a role in the regulation of light signaling and possibly auxin signaling.

10.581 kDa

MSGRRSRSRQSSGTSRISEDQINDLIIKLQQLLPELRDSRRSDKVSAARVLQDTCNYIRNLHREVDDLSERLSELLANSDTAQAALIRSLLTQ