ppp1r3b

Protein phosphatase 1 regulatory subunit 3B

301 amino acids

Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown (By similarity).

34.842 kDa

MPWISSHMNSSSVLDFFPHKTMAVDIAMKFYLRSPPLRRDRVECRIARKSNEPLRPCIQTTNKTLLSELSNQENKVKKRVSFADSRGLALTMVKVYSDFDDELEIPFNISELIDNIVNLTTVEKERFFLDFVQPSADYLDFRNRLQAESVCLENCMLKDKALVGTVKVKNLAFQKSVKIRMTCDSWQTYKDYDCLYVKDTYAGSDKDTFSFDVSLPEGIQSSASIEFAVCFECEGRIFWDSNKGLNYRIVRQDHRIPSDFESRHYDPVCLSVDQYGSPRCSYGIFPELQTYSGFDKLGPYY

ppp1r3b

Protein phosphatase 1 regulatory subunit 3B

293 amino acids

Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown (By similarity).

33.712 kDa

MPIELAMSLYLSSDEFLNPRASKYSRPLQPCLNQCKSSKLSFSSLKEQSEFNGVSRALMIPGRAKKHVSFADHKGLALTVVKIFSEFDDPIDIPDNIDNFFTSSLTVSEGKDKLTLDFDQPSADYLKFRQRIENDHVCLEHCMLKEKSIMGTVKVKNISFEKSVKLRITFNTWKNHTDVECQYVKDTYTGSNRDTFSFEASLPEQVPSHERIEFAICYEVNGDTLWDNNQGKNYRIIQSALRKSSNESNGGHQQYSQSDWDIHFDRYGSPRCSRGIFPHWPSYVGYEDIGPYY

PPP1R3B

Protein phosphatase 1 regulatory subunit 3B

285 amino acids

Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown. Its activity is inhibited by PYGL, resulting in inhibition of the glycogen synthase and glycogen phosphorylase phosphatase activities of PP1. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in hepatocytes (By similarity).

32.695 kDa

MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY

PPP1R3B

Protein phosphatase 1 regulatory subunit 3B

284 amino acids

Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown. Its activity is inhibited by PYGL, resulting in inhibition of the glycogen synthase and glycogen phosphorylase phosphatase activities of PP1. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in hepatocytes (By similarity).

32.383 kDa

MAVDIECRYSCMAPSLRRERFAFQIAPKPSKPLRPCIQLSGKNEASGTVAPTVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPLNITELLDSIVSLTTAESESFVLDFSQPSADYLDFRNRLQTDHVCLENCVLKDRSIAGTVKVQNLAFEKTVKVRMTFDTWKSFTDFPCWYVKDTYAGSDKDTFSFDISLPEKIQSYERMEFAVCYECNGQTYWDSNKGKNYRIIRAELQSTQGTAQPPNGPDFEIAFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY

Ppp1r3b

Protein phosphatase 1 regulatory subunit 3B

284 amino acids

Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown. Its activity is inhibited by PYGL, resulting in inhibition of the glycogen synthase and glycogen phosphorylase phosphatase activities of PP1. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in hepatocytes (By similarity).

32.433 kDa

MAVDIQYSYSSMAPSLRRERFTFKISPKLSKPLRPCIQLGSKDEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTAESESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKDKAIAGTVKVQNLAFEKVVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECNGQAYWDSNKGKNYRITRAELRSSPGKIEPYNGPDFGISFDQFGSPRCSFGLFPEWPSYLGYEKLGPYY

Ppp1r3b

Protein phosphatase 1 regulatory subunit 3B

284 amino acids

Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown. Its activity is inhibited by PYGL, resulting in inhibition of the glycogen synthase and glycogen phosphorylase phosphatase activities of PP1. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in hepatocytes.

32.626 kDa

MAVDIEYSYSSMAPSLRRERFTFKISPKLNKPLRPCIQLGSKDEAGRMVAPTVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTAESESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKEKAIAGTVKVQNLAFEKVVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECNGQSYWDSNKGKNYRITRAELRSTQGMTEPYNGPDFGISFDQFGSPRCSFGLFPEWPSYLGYEKLGPYY