POLR1C

DNA-directed RNA polymerases I and III subunit RPAC1

346 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity).

Belongs to the archaeal RpoD/eukaryotic RPB3 RNA polymerase subunit family.

39.116 kDa

MAAAQAVEEMRTRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEGGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHRVYTRHMTWVPLGNQADLFPEGAIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEIQGKKVARVANPRLDTFSREVFRNEKLKKVVRLARVRDHFIFSVESTGVLPPDVLVSEAIKVLMGKCQRFLDELDAVQMD

POLR1C

DNA-directed RNA polymerases I and III subunit RPAC1

346 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity).

Belongs to the archaeal RpoD/eukaryotic RPB3 RNA polymerase subunit family.

39.25 kDa

MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLARVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD

Polr1c

DNA-directed RNA polymerases I and III subunit RPAC1

346 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity).

Belongs to the archaeal RpoD/eukaryotic RPB3 RNA polymerase subunit family.

39.107 kDa

MAAAQAVEEMRTRVVLGEFGVRNVHTTDFPGNYAGYDDAWDQNRFEKNFRVDVVQMDEDTLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPILADPRLFEYRNQGEEEGTEIDTLQFRLQVRCTRNPNAAKDSSDPNELYVNHKVYTRHMTWVPLGNQADVFPEGTIRPVHDDILIAQLRPGQEIDLMMHCVKGIGKDHAKFSPVATASYRLLPAITLLEPVEGEAAEELSQCFSPGVIEVEEVQGKKVARVANARLDTFSREIFRHEKLKKAVRLARVRDHYIFSVESTGVLPPDVLVSEAIKILMGKCRRFLDELDAVEMD

polr1c

DNA-directed RNA polymerases I and III subunit rpac1

345 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity).

Belongs to the archaeal RpoD/eukaryotic RPB3 RNA polymerase subunit family.

39.443 kDa

MVNKSTTNGVSDPNLENKRTKVTLTNSGVENARGTYYSGAYTSVGYDNSFNLNRFKENFKINILSESANELVFEMIGIDAPIANALRRIMISEIPTMAIEKVYIINNTSILQDEVLAHRLGMIPIKVDPRKFNFKLPNKEYTAEDTLIFQLKVKCEKDSVTGKIINETALSKHLIWVPTQDQEEMFPNEEDRPRPMEDDIPIMKLRPGQVIDIQCYCEKNIGREHIKWSPVCTASYRLQPVISVDKSIKGDKANQLLEKCPKKVFDIEDSGQVVAARPLDCTMCRECIRDPEFEQNVKIERVRDHFIFSIESTGALKSREIFQEAIKIFIEKCNIVEESINKLVN