PM20D1

N-fatty-acyl-amino acid synthase/hydrolase PM20D1

517 amino acids

Bidirectional N-fatty-acyl amino acid synthase/hydrolase that regulates the production of N-fatty-acyl amino acids. These metabolites are endogenous chemical uncouplers of mitochondrial respiration. In an UCP1-independent manner, maybe through interaction with mitochondrial transporters, they promote proton leakage into the mitochondrial matrix. Thereby, this secreted protein may indirectly regulate the bodily dissipation of chemical energy as heat through thermogenic respiration.

Belongs to the peptidase M20A family.

57.162 kDa

MAGGCGRRRVVVCAVALGLSAAVLALTAVVLLRAYVLRSPAIPRLWARRGSTAAFSASERRELKEALRGAVRIPTVSLSSEDFNTTAMAEFGDYIRKAFPAVFSSKFIQHEIIGEYSHLFTVQGSDSEMMPYMLLAHMDVVPAPPEGWDFPPFSAAEHEGFIYGRGTLDNKNSAIGILQALEFLLRRNYRPRRSFYVGIGHDEEVFGQKGALKIAALLESRGVKLSFLLDEGSAILDGIIAGVKKPVALIAVTEKGLMTLNFTVEKEPGHSSFPPKETSIGILATAVSRLEQNPMRSLFGRGPELMTMEHLASEFNFPLNLIMSNLWLFSPIVSRVLAWKPSTNALIRTTTAVTMFNAGIKFNVIPPSARATVNFRIHSGEKAKEVLETVRNTVADDRVKIDVIEALDPLPISPWDDQTFGVHVFQRTILDTFPNVDSVVPGTCIGNTDSRHFTNVTNAIYRFNPVLLKSDDLPRIHGLNERISVESYEKQVEFLFQLIKNCDVDKLPEPHANSHEL

pm20d1

N-fatty-acyl-amino acid synthase/hydrolase PM20D1

512 amino acids

Bidirectional N-fatty-acyl amino acid synthase/hydrolase that regulates the production of N-fatty-acyl amino acids. These metabolites are endogenous chemical uncouplers of mitochondrial respiration. In an UCP1-independent manner, maybe through interaction with mitochondrial transporters, they promote proton leakage into the mitochondrial matrix. Thereby, this secreted protein may indirectly regulate the bodily dissipation of chemical energy as heat through thermogenic respiration.

Belongs to the peptidase M20A family.

56.71 kDa

MAVSRWKAVGSTLLAAFLVGLVVLIAVLLIRTYTLPTAVRKWNRNESLITELAEKERKQLVEALKGAIRIPTVSFSEEEQNTTALREFGEYIQKVFPQVFSSSLIQHEVLGGYSHLFKVQGSDHNLLPYMLLAHIDVVPAPPESWEVPPFSGEERDGYIYGRGTLDDKNCVIGILQSLEFLLKRGHKPRRSFYIGLGHDEEISGHKGAQKIVEKLQSQGVKLAFVLDEGLAVLDGVIQGISQPVALVGTTEKGSVTLDLTVNRLPGHSSMPPSETSIGILAAAVSRLEQNMMPNMFGNGPEQDMFEHLSTKFDFPLNIIMANLWLFSPILSRILELSPSTNAIVRTTTALTIFKAGIKSNVIPPTATATVNFRLHPAQTVQEVLDIVQNTIKDERVELSVLNSFDPLPVSPNDMSLGYHILQRTIHDVFSGPPVAPGVCVGNTDSRHFVNLTNSIYRFSPVVLKKEDVDRIHGLNERISKEAIELLVQFYIQLIQNSDTDNIPPPHLDTHEL

PM20D1

N-fatty-acyl-amino acid synthase/hydrolase PM20D1

503 amino acids

Bidirectional N-fatty-acyl amino acid synthase/hydrolase that regulates the production of N-fatty-acyl amino acids. These metabolites are endogenous chemical uncouplers of mitochondrial respiration. In an UCP1-independent manner, maybe through interaction with mitochondrial transporters, they promote proton leakage into the mitochondrial matrix. Thereby, this secreted protein may indirectly regulate the bodily dissipation of chemical energy as heat through thermogenic respiration.

Belongs to the peptidase M20A family.

55.785 kDa

MARPSVCLLASLSALLLGIAAVSRSKGLRGTESQREPRIPSQFSQEQRIAMKEALKGAIQIPTVSFSPKELNTTALAEFGEYIRKVFPTVFHTSFIRHEVVGNYSHLFTIKGSDPSMQPYILLAHIDVVPAPDKGWDVPPFSGLERDGFIYGRGTLDNKNYLMAILQALELLLIRNYIPRRSFFIALGHDEEISGINGAQKISALLQARGVQLAFVVDEGSFILDGFIPYLKKPFAMVSVSEKGAINLMLQVNTTTGHSSAPPKETSIGILAAAVSRLEQTPMPNMFGSGPLMTAVEQLANEFPFPTNIVLNNLWLFRPLVSRLMERNYITNSLVRTTTALTMFNAGVKVNVIPPVAEAIINFRLHPAQTVQEVLKLAKDIVADDRIQFHVLDAFDPLPISPSDDQALGYQLLRQTIHSVFPEVNIVAPGTCIGNTDSRHYLNLTTGIYRFNPIYLQPQDFSSIHGINEKISVQAYETQVKFVFEFIQNGDTDEETVPHLHEL

Pm20d1

N-fatty-acyl-amino acid synthase/hydrolase PM20D1

503 amino acids

Bidirectional N-fatty-acyl amino acid synthase/hydrolase that regulates the production of N-fatty-acyl amino acids. These metabolites are endogenous chemical uncouplers of mitochondrial respiration. In an UCP1-independent manner, maybe through interaction with mitochondrial transporters, they promote proton leakage into the mitochondrial matrix. Thereby, this secreted protein may indirectly regulate the bodily dissipation of chemical energy as heat through thermogenic respiration.

Belongs to the peptidase M20A family.

55.663 kDa

MAELLASLPAWAAVLLLFFATVSGSTGPRSRENRGASRIPSQFSEEERVAIKEALKGAIQIPTVSFSHEESNTTALAEFGEYIRKAFPTVFHSSLVQHEVVAKYSHLFTIQGSDPSLQPYMLMAHIDVVPAPEEGWEVPPFSGLERNGFIYGRGALDNKNSVMAILHALELLLIRNYSPKRSFFIALGHDEEVSGEKGAQKISALLQARGVQLAFLVDEGSFILEGFIPNLEKPVAMISVTEKGALDLMLQVNMTPGHSSAPPKETSIGILSAAVSRLEQTPMPNMFGGGPLKKTMKLLANEFSFPINIVLRNLWLFHPIVSRIMERNPITNALVRTTTALTMFNAGIKVNVIPPLAQATINCRIHPSQTVHEVLELVKNTVADDRVQLHVLRSFEPLPISPSDDQAMGYQLLQETIRSVFPEVDIVVPGICIANTDTRHYANITNGMYRFNPLPLNPQDFSGVHGINEKVSVQNYQNQVKFIFEFIQNADTYKEPVPHLHEL

PM20D1

N-fatty-acyl-amino acid synthase/hydrolase PM20D1

502 amino acids

Bidirectional N-fatty-acyl amino acid synthase/hydrolase that regulates the production of N-fatty-acyl amino acids. These metabolites are endogenous chemical uncouplers of mitochondrial respiration. In an UCP1-independent manner, maybe through interaction with mitochondrial transporters, they promote proton leakage into the mitochondrial matrix. Thereby, this secreted protein may indirectly regulate the bodily dissipation of chemical energy as heat through thermogenic respiration.

Belongs to the peptidase M20A family.

55.741 kDa

MAQRCVCVLALVAMLLLVFPTVSRSMGPRSGEHQRASRIPSQFSKEERVAMKEALKGAIQIPTVTFSSEKSNTTALAEFGKYIHKVFPTVVSTSFIQHEVVEEYSHLFTIQGSDPSLQPYLLMAHFDVVPAPEEGWEVPPFSGLERDGIIYGRGTLDDKNSVMALLQALELLLIRKYIPRRSFFISLGHDEESSGTGAQRISALLQSRGVQLAFIVDEGGFILDDFIPNFKKPIALIAVSEKGSMNLMLQVNMTSGHSSAPPKETSIGILAAAVSRLEQTPMPIIFGSGTVVTVLQQLANEFPFPVNIILSNPWLFEPLISRFMERNPLTNAIIRTTTALTIFKAGVKFNVIPPVAQATVNFRIHPGQTVQEVLELTKNIVADNRVQFHVLSAFDPLPVSPSDDKALGYQLLRQTVQSVFPEVNITAPVTSIGNTDSRFFTNLTTGIYRFYPIYIQPEDFKRIHGVNEKISVQAYETQVKFIFELIQNADTDQEPVSHLHKL