PLN

Lon protease homolog 2, peroxisomal

935 amino acids

ATP-dependent serine protease that mediates the selective degradation of misfolded and unassembled polypeptides in the peroxisomal matrix. Necessary for type 2 peroxisome targeting signal (PTS2)-containing protein processing and facilitates peroxisome matrix protein import.

Belongs to the peptidase S16 family.

104.88 kDa

MSSKSSAWQVELPVHRLERNLIFLPGITYRVVFDKQKALDLASRWSAKERSERVAAIASRFGLSSKHLVACVPGYPDSDTCTVCVVNGFYEMSETTVVSFKGVTRGYIVQSDEDTATVEIQEETSVPHPDTKDMIRLFDNIDQFLTYYKDEGTLDSEDKEERSRHILLRLTPLATLLNAQLSASDVSAGLKRLRQAYGRKSGDFAHYNDVLVALFPFPIELKISYLRSKGAERIEVFNKCVAFANKVFEEHLDTSYLAEIWSSLDHHSSKAQSNVSRSQFISNHLRNLRRLVEEMGLMRVTGRGSRTAEDNDENKSIQDFVDSLDKYLINEDGKRLIAKDFERLKQMQSSSSDYQVLRAYLEIIMDLPWQRLDSFVESVNVDLARAREQLDADHYGMESAKERILEYLAVLNLHNQKQPRHEPEFVYGTGDEPTTKERPASTLKAPILLLTGPPGVGKTSLARSIATTLGRKFQRISVGGLNDFADLKGHRRTYVGAIPGLIVQALRRSQSMNPVILLDEVDKIGSNSRKGDPEAALLEILDPEQNTNFHDHYIGFPIDLSQILFVCTSNDLWQLSDPLRDRMEVIELAGYNYMEKVEISKKYLIPRQLERAGLSSDAVAMDDETILKMATHYTSEPGIRNLERLIAAICRGKAVERQMGEATKTVTVHDLAKYIGSPSHLRATAAGETKFQKGYGVVNGLSYNSDGSGSLLRFEMIGLPGSQKMNCTGRLGEVLLESSQIANTLVGYLLHNNLVAGTQEFRDELLKRYENTSVHLHVPEGAISKDGPSAGITMTLCLMSLVLRKKVPETLAMTGEITLTGKVLPIGGVREKLLGAHLAGKVNKVLLPRQNRKDVIEDFIYNLRNRELAKELFAKFLDEEEQLLKEGRTHAGEPEKWVYQTLGLEIVYVDDFSDVLASVWEGEVLLTGGIREARI

PLN

Cardiac phospholamban

52 amino acids

Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation (By similarity).

Belongs to the phospholamban family.

6.054 kDa

MDKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLISICLLLICIIVMLL

PLN

Cardiac phospholamban

52 amino acids

Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation (By similarity).

Belongs to the phospholamban family.

6.08 kDa

MDKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL

PLN

Cardiac phospholamban

52 amino acids

Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation (By similarity).

Belongs to the phospholamban family.

6.091 kDa

MEKVQYITRSALRRASTLEVNPQARQRLQELFVNFCLILICLLLICIIVMLL

PLN

Cardiac phospholamban

52 amino acids

Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation.

Belongs to the phospholamban family.

6.109 kDa

MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

Pln

Cardiac phospholamban

52 amino acids

Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation.

Belongs to the phospholamban family.

6.095 kDa

MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL

PLN

Cardiac phospholamban

52 amino acids

Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation (By similarity).

Belongs to the phospholamban family.

6.08 kDa

MDKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL

PLN

Cardiac phospholamban

52 amino acids

Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation (By similarity).

Belongs to the phospholamban family.

6.095 kDa

MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL

Pln

Cardiac phospholamban

52 amino acids

Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation (By similarity).

Belongs to the phospholamban family.

6.095 kDa

MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL