About Products Protein Database Contact

PLES_48441

Gene
PLES_48441
Protein
Nucleotide-binding protein PLES_48441
Organism
Pseudomonas aeruginosa (strain LESB58)
Length
286 amino acids
Function
Displays ATPase and GTPase activities.
Similarity
Belongs to the RapZ-like family.
Mass
32.219 kDa
Sequence
MRLIIVSGRSGSGKSTALNVLEDNGFYCIDNLPASLLPDLAQRALLHTELLQPQVAVSIDARNLPSQLQRFPELLQEVRDNHINCDVLYLDADDETLLKRFSETRRRHPLTTDTRSLAEAIGDESQLLGPIADLADLKLDTTSLNLYQLRDTIKLRLLNKPEPGTAFLVESFGFKRGMPVDADLVFDVRCLPNPYWKPELRDHSGLEPEVREYLAAQPDVEEMYQDIVGYLNKWLPRFAASNRSYVTVAIGCTGGHHRSVYLAERIGAALRDSLKNVQIRHRDLSS