About Products Protein Database Contact

PL1_3014

Gene
PL1_3014
Protein
Nucleobase transporter PlUacP
Organism
Paenibacillus larvae subsp. larvae (strain NRRL B-3650 / LMG 16245)
Length
434 amino acids
Function
Uptake of the purines adenine and guanine, and the pyrimidine uracil. Transport is probably proton-dependent.
Similarity
Belongs to the xanthine/uracil permease family. Nucleobase:cation symporter-2 (NCS2) (TC 2.A.40) subfamily.
Mass
45.792 kDa
Sequence
MRKSKVLTLGFQHVLAMYAGAVIVPLIVGSSLKLNAEQLAYLVSIDLLTCGIATLLQVWRNKFFGIGLPVMLGCTFTAVGPMIAIGSEYGMPAIYGSVLASGLFLALFAGFFGKLARFFPPIVTGSVVTIIGITLIPVAVQDMGGGQGSADFGSLSNLALSFGVLLFIILANRFFTGFIRAISILLGLIFGTIAGAFMGKVDIGPLLDASWFHGIHPFYFGFPTFHLPSILTMTLVAIVSVMESTGVFVALGKITEKELTADDLKRGYRSEGLASILGSIMNSFPYTTYSQNVGLIQISKVKSRDVVITAGFILVILGFMPKIAALTLLIPTAVLGGAMIAMFGMVVSSGIKMLGAIDLNNHENLLIIACSVSVGLGVTVAPNLFDHLPDSIKILTSNGIVAGSLTAILMNFLFTVGRKKQDESHASAENVHAA