About Products Protein Database Contact

PKSB

Gene
PKSB
Protein
Type III polyketide synthase B
Organism
Arabidopsis thaliana
Length
392 amino acids
Function
Plant type III polyketide synthases (PKSs) that catalyzes the condensation of malonyl-CoA units with various CoA ester starter molecules to generate a diverse array of natural products including long-chain alkyl alpha-pyrones. Accepts up to C(20) chain-length fatty acyl CoAs as starter substrates, and carries out sequential condensations with malonyl-CoA to produce triketide and tetraketide alpha-pyrones, potential sporopollenin precursors (PubMed:19043200, PubMed:21193570). Favorite substrates for are midchain- and v-hydroxylated fatty acyl-CoAs (e.g. 12-hydroxyoctadecanoyl-CoA and 16-hydroxyhexadecanoyl-CoA). Required for pollen development and sporopollenin biosynthesis, the major constituent of exine in the outer pollen wall (PubMed:21193570, PubMed:20442277). In vitro, can use 4-coumaroyl-coenzyme A as substrate to produce bis-noryangonin and fatty acyl-coenzyme A as substrate to produce medium-chain alkyl pyrones. May play a role in both the synthesis of pollen fatty acids and phenolics found in exine (PubMed:20442277).
Similarity
Belongs to the thiolase-like superfamily. Chalcone/stilbene synthases family.
Mass
42.982 kDa
Sequence
MGSIDAAVLGSEKKSNPGKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEEILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISDITHVVYVSSSEARLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTIIGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFELHTAIQNFLPETEKTIDGRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHKNYNQMFWAVHPGGPAILNRIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNEEENEWGLILAFGPGVTFEGIIARNLDV

Gene
pksB
Protein
Probable polyketide biosynthesis zinc-dependent hydrolase PksB
Organism
Bacillus subtilis (strain 168)
Length
225 amino acids
Function
Probably involved in some intermediate steps for the synthesis of the antibiotic polyketide bacillaene which is involved in secondary metabolism.
Similarity
Belongs to the metallo-beta-lactamase superfamily.
Mass
25.908 kDa
Sequence
MNLTYKVHPIKTRYQGWTNYCYIIEDIVSRSAIVVDPSWELSKITTTLSELEAELKAVALTHSHYDHVNLVDPLTKMFNAQVYMSKKEIDYYQFRCRNLISLDDHQTISIGNTRAQCLLTPGHTAGGMCYLFSESIFTGDTVFTEGCGICEDDGSSAEEMFDSIQRIKSEVSPHVRVYPGHSFGKSPGHSIKDLYQHNIYFQIDKKEYFVKFRTRKNQKGIFDFK