Function
Auxin transporter regulating intracellular auxin homeostasis and metabolism (PubMed:19506555, PubMed:20439545). Mediates the auxin transport from the cytosol into the lumen of the endoplasmic reticulum (PubMed:19506555). May also act as an auxin efflux carrier when located to the cell membrane (PubMed:24692422). PIN5 and PIN8 may have an antagonistic/compensatory activity (PubMed:22760640, PubMed:22990451). Involved in unfolded protein response (UPR) activation (PubMed:24180465). Involved in the control of vein patterning (PubMed:24304505). Promotes vein formation (PubMed:26560462). PIN5, PIN6, and PIN8 control vein network geometry, but they are expressed in mutually exclusive domains of leaf vascular cells (PubMed:26560462).
Sequence
MINCGDVYKVIEAMVPLYVALILGYGSVKWWHIFTRDQCDAINRLVCYFTLPLFTIEFTAHVDPFNMNYRFIAADVLSKVIIVTVLALWAKYSNKGSYCWSITSFSLCTLTNSLVVGVPLAKAMYGQQAVDLVVQSSVFQAIVWLTLLLFVLEFRKAGFSSNNISDVQVDNINIESGKRETVVVGEKSFLEVMSLVWLKLATNPNCYSCILGIAWAFISNRWHLELPGILEGSILIMSKAGTGTAMFNMGIFMALQEKLIVCGTSLTVMGMVLKFIAGPAAMAIGSIVLGLHGDVLRVAIIQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPVLVAYYAALEFIH