PIM3

Serine/threonine-protein kinase pim-3

326 amino acids

Proto-oncogene with serine/threonine kinase activity that can prevent apoptosis, promote cell survival and protein translation. May contribute to tumorigenesis through: the delivery of survival signaling through phosphorylation of BAD which induces release of the anti-apoptotic protein Bcl-X(L), the regulation of cell cycle progression, protein synthesis and by regulation of MYC transcriptional activity. Additionally to this role on tumorigenesis, can also negatively regulate insulin secretion by inhibiting the activation of MAPK1/3 (ERK1/2), through SOCS6. Involved also in the control of energy metabolism and regulation of AMPK activity in modulating MYC and PPARGC1A protein levels and cell growth.

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. PIM subfamily.

35.891 kDa

MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGVPESCDLRLCTLDPDDVASTTSSSESL

Pim3

Serine/threonine-protein kinase pim-3

326 amino acids

Proto-oncogene with serine/threonine kinase activity that can prevent apoptosis and promote cell survival and protein translation. May contribute to tumorigenesis through: the delivery of survival signaling through phosphorylation of BAD which induces release of the anti-apoptotic protein Bcl-X(L), the regulation of cell cycle progression and protein synthesis and by regulation of MYC transcriptional activity. Additionally to this role on tumorigenesis, can also negatively regulate insulin secretion by inhibiting the activation of MAPK1/3 (ERK1/2), through SOCS6. Involved also in the control of energy metabolism and regulation of AMPK activity in modulating MYC and PPARGC1A protein levels and cell growth.

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. PIM subfamily.

35.97 kDa

MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKVYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGVAVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHNCGVVHRDIKDENLLVDLRSGELKLIDFGSGAVLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLFFRRRVSPECQQLIEWCLSLRPSERPSLDQIAAHPWMLGTEGSVPENCDLRLCALDTDDGASTTSSSESL

Pim3

Serine/threonine-protein kinase pim-3

326 amino acids

Proto-oncogene with serine/threonine kinase activity that can prevent apoptosis and promote cell survival and protein translation. May contribute to tumorigenesis through: the delivery of survival signaling through phosphorylation of BAD which induces release of the anti-apoptotic protein Bcl-X(L), the regulation of cell cycle progression and protein synthesis and by regulation of MYC transcriptional activity. Additionally to this role on tumorigenesis, can also negatively regulate insulin secretion by inhibiting the activation of MAPK1/3 (ERK1/2), through SOCS6. Involved also in the control of energy metabolism and regulation of AMPK activity in modulating MYC and PPARGC1A protein levels and cell growth (By similarity).

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. PIM subfamily.

36.002 kDa

MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKVYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGMAVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHNCGVVHRDIKDENLLVDLRSGELKLIDFGSGAVLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLFFRRRVSPECQQLIEWCLSLRPSERPSLDQIAAHPWMLGTEGSVPENCDLRLCALDTDDGASTTSSSESL

PIM3

Serine/threonine-protein kinase pim-3

323 amino acids

Proto-oncogene with serine/threonine kinase activity that can prevent apoptosis and promote cell survival and protein translation.

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. PIM subfamily.

36.597 kDa

MLLSKFGSLAHICSPASMDHLPVKILPPVKVEKEPFDKVYQVGSVLGSGGFGTVYAGSRTADGLPVAVKHVVKERVTEWGTIGGVMVPLEIVLLKKVGSGFRGVIKLLDWYERPDGFLIVMERPELVKDLFDFITEKGALDEDTARGFFRQVLEAVRHCYGCGVVHRDIKDENLLVDLRTGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLYFRRRISPECQQLIKWCLSLRPSDRPTLEQIFDHQWMHKSEVVKSEDCDIRLRTLDTDVSSTSSSNESL

pim3

Serine/threonine-protein kinase pim-3

323 amino acids

Proto-oncogene with serine/threonine kinase activity that can prevent apoptosis and promote cell survival and protein translation.

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. PIM subfamily.

36.964 kDa

MLLSKFGSLAHICNPSNMEHLPVKILQPVKVDKEPFEKVYQVGSVVASGGFGTVYSDSRIADGQPVAVKHVAKERVTEWGTLNGVMVPLEIVLLKKVPTAFRGVINLLDWYERPDAFLIVMERPEPVKDLFDYITEKGPLDEDTARGFFRQVLEAVRHCYNCGVVHRDIKDENLLVDTRNGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWVRYHRYHGRSATVWSLGVLLYDMVYGDIPFEQDEEIVRVRLCFRRRISTECQQLIKWCLSLRPSDRPTLEQIFDHPWMCKCDLVKSEDCDLRLRTIDNDSSSTSSSNESL