PIGX

Phosphatidylinositol-glycan biosynthesis class X protein

258 amino acids

Essential component of glycosylphosphatidylinositol-mannosyltransferase 1 which transfers the first of the 4 mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase PIGM (By similarity).

Belongs to the PIGX family.

28.788 kDa

MAARVAAVRAAAWLLLGAATGLTRGPAAAFTAARSDAGIRAMCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITILCSTLILVAVFKYGHFSL

Pigx

Phosphatidylinositol-glycan biosynthesis class X protein

254 amino acids

Essential component of glycosylphosphatidylinositol-mannosyltransferase 1 which transfers the first of the 4 mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase PIGM (By similarity).

Belongs to the PIGX family.

28.644 kDa

MAAGAVAWLLLWAAWLVGRLAADFSDAPFSAGKGVRATCSEIILRQEFLKDGFHRDLLIKVKFGESIEDLQTCRLLIKHYIPPGLFVDPYELASLRERNLTEAVMLSESFNIEAPNYLSNESAVLIYARQDAQCIDCFQAFLPVHYRYHRPHKKDGDTLIVVNNPDLLMYCDQEFPILKCWAQSEVAAPCALKSEEICQWKSMQYKSILKNLTVQVPVGLTIHTSLVCSVTLLITILCSTLILLAVFKYGHFSL

Pigx

Phosphatidylinositol-glycan biosynthesis class X protein

252 amino acids

Essential component of glycosylphosphatidylinositol-mannosyltransferase 1 which transfers the first of the 4 mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase PIGM.

Belongs to the PIGX family.

28.423 kDa

MAASALAWLLLWAAGLVGRLAADISDARFSDGVRATCSEIILRQEFLKDGFHRDLLIKVKFGESIEDLQTCRLLIKHYIPTGLFVDPYELASLRERNITEAVMVSESFNLEAPNYLSTESAVLIYARQDAQCIDCFQAFLPVHYRYHRPHKKDGDTLIVVNNPDLLMHCDQEFPILKCWAQSEVAAPCSLKSEEICQWKNMQYKSILKNLTVQVPVGLTIHTSLVCSVTLLITVLCSTLILLAVFKYGHFSL