About Products Protein Database Contact

PHM8

Gene
PHM8
Protein
Phosphate metabolism protein 8
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
321 amino acids
Function
May be involved in phosphate metabolism.
Similarity
Belongs to the SSM1 family.
Mass
37.719 kDa
Sequence
MTIAKDYRTIYRNQIKKQIRLNQEHLQSLTHLGSQINFEVDPPKLPDPDPARKVFFFDIDNTLYRKSTKVQLLMQQSLSNFFKYELGFDDDEAERLIESYYQEYGLSVKGLIKNKQIDDVLQYNTFIDDSLPLQDYLKPDWKLRELLINLKKKKLGKFDKLWLFTNSYKNHAIRCVKILGIADLFDGITYCHYDRPIEEEFICKPDPKFFETAKLQSGLSSFANAWFIDDNESNVRSALSMGMGHVIHLIEDYQYESENIVTKDHKNKQQFSILKDILEIPLIMDVEVYRPSSIAIKEMEELEEEGEAVNWSNQQINVQSS