PHLDA2

Pleckstrin homology-like domain family A member 2

152 amino acids

Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids (By similarity).

Belongs to the PHLDA2 family.

17.092 kDa

MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP

Phlda2

Pleckstrin homology-like domain family A member 2

144 amino acids

Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids.

Belongs to the PHLDA2 family.

16.727 kDa

MASKIVMSSKTVKTSDEILCEGELEKRSDSLFQVWKKKRCVLTADRLRLFSGKTSPAKELFFHSILKVDCVEHTSKYVYFTIVTNYYKEIDFRCTVESCWNAAITMALIDFQNRRALQDFPRYRYQRSESEMPSEPGEQSALGP

PHLDA2

Pleckstrin homology-like domain family A member 2

142 amino acids

Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids (By similarity).

Belongs to the PHLDA2 family.

15.868 kDa

MRSPGEVLREGELEKRSDSLLQVWKKKRGVLTTDRLRLFPTGPGARPKELRFHSILKVDCVERTGKYVYFTIVTTDRKEIDFRCAGESYWNASITLALIDFQNRRAMQDFRSRRERAAAAAAAAAAAAAAEQEPEAGPGGQP

phlda2

Pleckstrin homology-like domain family A member 2

138 amino acids

Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids (By similarity).

Belongs to the PHLDA2 family.

15.962 kDa

MKMSAEQISEVLKEGELEKRSDNLLQFWKRKTCVLTTDSLNIYADTQKRTKSKELKLQSIKKVDCVERTGKFVYFTIVTTDNKEIDFRCSGDDNCWNAVITMALIDFQNRKAIQDFKTRQDDESGSPGQHESRMARAP

phlda2

Pleckstrin homology-like domain family A member 2

136 amino acids

Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids (By similarity).

Belongs to the PHLDA2 family.

15.709 kDa

MTGSDISHILKEGELEKRSDNLLQFWKRKTCVLTTDSLNIYTDQQKKNKSKELKLQSIKKVDCVEHTGKFVYFTIVTTDNKEIDFRCSDEKNCWNAVIAIALVNFQNRKAIQGFKTQKESENTSLGQQERCMARAP

phlda2

Pleckstrin homology-like domain family A member 2

136 amino acids

Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids (By similarity).

Belongs to the PHLDA2 family.

15.786 kDa

MSVCGGAPPPAILKEGDLEKRSDSFLQLWKKRRCVLTADGLHLYSDARKRGKAKVLRFDSLAKLECVEWKGERVYFTLVTLGGQEIDFRCRERSRWNAEITLALVGFQNRRAVRELRERKEHQARDNGERLRSWGP

phlda2

Pleckstrin homology-like domain family A member 2

125 amino acids

Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids (By similarity).

Belongs to the PHLDA2 family.

14.327 kDa

MQPGQAVIMEGELEKRSDNLLQFWRKKLCVLTKESLSLFPDAQKKSKCKELKFQSIKKVDCVERTGKYIYFTIVTTDNKEIDFRCLDQSAWNAAITLALIEFQNKAAVQSFRSQQGTNTRVAPCV