PGF

Placenta growth factor

221 amino acids

Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth.

Belongs to the PDGF/VEGF growth factor family.

24.789 kDa

MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR

Pgf

Placenta growth factor

158 amino acids

Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Also promotes cell tumor growth (By similarity).

Belongs to the PDGF/VEGF growth factor family.

17.876 kDa

MLVMKLFTCFLQVLAGLAVHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP

Pgf

Placenta growth factor

158 amino acids

Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Also promotes cell tumor growth (By similarity).

Belongs to the PDGF/VEGF growth factor family.

17.681 kDa

MLAMKLFTCFLQVLAGLAVHSQGALSAGNNSTEMEVVPFNEVWGRSYCRPMEKLVYIADEHPNEVSHIFSPSCVLLSRCSGCCGDEGLHCVALKTANITMQILKIPPNRDPHSYVEMTFSQDVLCECRPILETTKAERRKTKGKRKQSKTPQTEEPHL

PGF

Placenta growth factor

149 amino acids

Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Also promotes cell tumor growth (By similarity).

Belongs to the PDGF/VEGF growth factor family.

17.094 kDa

MPTVRLFTCFLQLLTGLVLPAVPTTQWALSPGNISSEVEVVPFQQVWSRSYCRPVERLVDIVSEYPSEMEHLFSPSCVSLMRCTGCCSDESMHCVPLETANVTMQLMKYRSLDQPFFVEMSFSQHVRCECKPLWEKMKQTRCGDTISQR