Pfdn4

Probable prefoldin subunit 4

138 amino acids

Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins (By similarity).

Belongs to the prefoldin subunit beta family.

15.936 kDa

MAAKVASGTNKVFQNHDDVHISFEDQQRINRFAKHNARMDDFKAELETKRNELKSLEEALEEIELFDEDEDIPFLVGEVFLSHKLEKTQDMLKETKEQVLKEIAGVEAKAKVIKAEMDELKAHLYQRFGSNISLEAED

PFDN4

Prefoldin subunit 4

134 amino acids

Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins (By similarity).

Belongs to the prefoldin subunit beta family.

15.328 kDa

MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACEDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES

PFDN4

Prefoldin subunit 4

134 amino acids

Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.

Belongs to the prefoldin subunit beta family.

15.314 kDa

MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES

pfdn4

Probable prefoldin subunit 4

132 amino acids

Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins (By similarity).

Belongs to the prefoldin subunit beta family.

15.479 kDa

MSKTMIEKVDEVLETEVCAADQKMINLFGRLNNRKHELMREKKAKQEDLEKATDSQDDLFIADDDSKFKYSMGEAFLEVNKEDAESLIEKYINKLEEDIKKIDSDINDINEKHKELKVILYAKFKNSINLEE