PER66

Peroxidase 66

322 amino acids

Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.

Belongs to the peroxidase family. Classical plant (class III) peroxidase subfamily.

35.56 kDa

MAFSKGLIFAMIFAVLAIVKPSEAALDAHYYDQSCPAAEKIILETVRNATLYDPKVPARLLRMFFHDCFIRGCDASILLDSTRSNQAEKDGPPNISVRSFYVIEDAKRKLEKACPRTVSCADVIAIAARDVVTLSGGPYWSVLKGRKDGTISRANETRNLPPPTFNVSQLIQSFAARGLSVKDMVTLSGGHTIGFSHCSSFESRLQNFSKFHDIDPSMNYAFAQTLKKKCPRTSNRGKNAGTVLDSTSSVFDNVYYKQILSGKGVFGSDQALLGDSRTKWIVETFAQDQKAFFREFAASMVKLGNFGVKETGQVRVNTRFVN

PER66

Peroxidase 66

320 amino acids

Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.

Belongs to the peroxidase family. Classical plant (class III) peroxidase subfamily.

33.419 kDa

MAASVSASCLNRLSSLAVVLVALASAASAQLSSTFYDRSCPNALSTIRSGVNSAVRQEPRVGASLLRLHFHDCFVRGCDASLLLNDTSGEQSQGPNLTLNPRGFVVVNSIKAQVESVCPGIVSCADILAVAARDGVVALGGPSWTVLLGRRDSTASFAGQTSDLPPPTSSLGQLLSAYNKKNLNPTDMVALSGAHTIGQAQCSSFNDHIYNDTNINSAFAASLRANCPRAGSTALAPLDTTTPNAFDNAYYTNLLSQKGLLHSDQELFNSGSTDSTVRSFASSTSAFNSAFATAMVKMGNLSPQTGTQGQIRRSCWKVNS