PE13

PE family protein PE13

99 amino acids

May play a pivotal role in the interaction between M.tuberculosis and host. Can enhance the survival within macrophages under stress conditions such as H(2)O(2), SDS and low pH. Increases the production of IL-6 and IL-1beta from macrophages, and decreases the secretion of suppressor of cytokine signaling 3 (SOCS-3). These changes probably involve the p38-ERK-NF-kappa-B signaling pathway. Also precipitates the macrophage death.

Belongs to the mycobacterial PE family.

9.616 kDa

MSFVMAYPEMLAAAADTLQSIGATTVASNAAAAAPTTGVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAAS