PDRP1

Probable pyruvate, phosphate dikinase regulatory protein, chloroplastic

471 amino acids

Bifunctional serine/threonine kinase and phosphorylase involved in the dark/light-mediated regulation of PPDK by catalyzing its phosphorylation/dephosphorylation. Dark/light-induced changes in stromal concentrations of the competing ADP and Pi substrates govern the direction of the reaction. In the dark, phosphorylates the catalytic intermediate of PPDK (PPDK-HisP), inactivating it. Light exposure induces the phosphorolysis reaction that reactivates PPDK (By similarity).

Belongs to the pyruvate, phosphate/water dikinase regulatory protein family. PDRP subfamily.

51.076 kDa

MSSSSSTSPRFGSMISAKLASPPPSLLLPPSPRLQGRRLTPPSCTPGTPAALPSPGPDKEPEREAAGSGSGSATTPRSPAQLGSSQLHRWSRARAHRSGRRLEWPTIRDRGSGGASSPPTPTRPHPSSDEAASAAAKVAVEEEDGYGVVGRDEAAKSIYMVSDGTGWTAEHSVNAALGQFEHCLVDRGCAVNTHLFNGIDDMDRLIEIVKQAAKEGALVLYTLADPSMAEATKKACELWGVPSNDILRPTIEAIASHIGVAPSGIPRSSPSRKGQLTEDYFRRIEAIDFTIKQDDGAQPQNLNRAHIVLVGVSRTGKTPLSIYLAQKGYKVANVPIVMGVNLPKSLFEIDQDKIFGLTINPVVLQAIRKARAKTLGFHGQKSNYAEMEHVRGELDHANQIFAQHPIWPVIEVTGKAIEETAAVVVRIFHDRKQKCAMPRISKRVAPIRIYDYLSEMVNTHVEYQKIFARDF

PDRP1

Probable pyruvate, phosphate dikinase regulatory protein, chloroplastic

471 amino acids

Bifunctional serine/threonine kinase and phosphorylase involved in the dark/light-mediated regulation of PPDK by catalyzing its phosphorylation/dephosphorylation. Dark/light-induced changes in stromal concentrations of the competing ADP and Pi substrates govern the direction of the reaction. In the dark, phosphorylates the catalytic intermediate of PPDK (PPDK-HisP), inactivating it. Light exposure induces the phosphorolysis reaction that reactivates PPDK (By similarity).

Belongs to the pyruvate, phosphate/water dikinase regulatory protein family. PDRP subfamily.

51.076 kDa

MSSSSSTSPRFGSMISAKLASPPPSLLLPPSPRLQGRRLTPPSCTPGTPAALPSPGPDKEPEREAAGSGSGSATTPRSPAQLGSSQLHRWSRARAHRSGRRLEWPTIRDRGSGGASSPPTPTRPHPSSDEAASAAAKVAVEEEDGYGVVGRDEAAKSIYMVSDGTGWTAEHSVNAALGQFEHCLVDRGCAVNTHLFNGIDDMDRLIEIVKQAAKEGALVLYTLADPSMAEATKKACELWGVPSNDILRPTIEAIASHIGVAPSGIPRSSPSRKGQLTEDYFRRIEAIDFTIKQDDGAQPQNLNRAHIVLVGVSRTGKTPLSIYLAQKGYKVANVPIVMGVNLPKSLFEIDQDKIFGLTINPVVLQAIRKARAKTLGFHGQKSNYAEMEHVRGELDHANQIFAQHPIWPVIEVTGKAIEETAAVVVRIFHDRKQKCAMPRISKRVAPIRIYDYLSEMVNTHVEYQKIFARDF

PDRP1

Pyruvate, phosphate dikinase regulatory protein, chloroplastic

426 amino acids

Bifunctional serine/threonine kinase and phosphorylase involved in the dark/light-mediated regulation of PPDK by catalyzing its phosphorylation/dephosphorylation. Dark/light-induced changes in stromal concentrations of the competing ADP and Pi substrates govern the direction of the reaction. In the dark, phosphorylates the catalytic intermediate of PPDK (PPDK-HisP), inactivating it. Light exposure induces the phosphorolysis reaction that reactivates PPDK. Phosphorylates PPDK at both Ser-528 and Thr-527 (PubMed:24710069). Can use ADP as a high specificity substrate and GDP as a lower affinity substrate, but has no activity with UDP (PubMed:21414960).

Belongs to the pyruvate, phosphate/water dikinase regulatory protein family. PDRP subfamily.

45.905 kDa

MIGCAKPLAAPLQAWARPPSPAGRRLPPSFCAPDTSPALTRAVESPGQSQSDDAPPPRSGEAASSLAPRASSHLDRWSRSRALRSGHRPALNRAALSSASVSAPPVIKSPRPEDAAVAAEDGEDDDVCEAERDAAAGKAIYIVSDGTGWTAEHSVNAALGQFENCLADRGCAVNTHLFSLIDDMDRLIEVIKQAAKEGALVLYTLADPSMAEATKKACDFWGVPCTDVLRPTVEAIASHIGVAPSGIPRSFPSRNGRLSEDYFQRIDAIDFTIKQDDGVLPQNFYRADIVLAGVSRTGKTPLSIYLAQKGYKVANVPIVMGVALPKSLFEINQDKVFGLTINPAILQGIRKTRAKTLGFDGRQSNYAEMDHVRQELVHANQIFVQNPWWPVIAVTGKAIEETAAVILGILHDRKQKCSMPRISKRY