pdh2

Pyranose dehydrogenase 2

600 amino acids

Catalyzes the single-oxidation or sequential double oxidation reaction of carbohydrates primarily at carbon-2 and/or carbon-3 with the concomitant reduction of the flavin. The enzyme exhibits a broad sugar substrate specificity, oxidizing different aldopyranoses to the corresponding C-1, C-2, C-3 or C-1,2, C-2,3 and C-3,4 (di)dehydro sugars with substrate-specific regioselectivity. Accepts only a narrow range of electron acceptors such as substituted benzoquinones and complexed metal ions and reacts extremely slowly with O(2) as acceptor. May play a role in the natural recycling of plant matter by oxidizing all major monosaccharides in lignocellulose and by reducing quinone compounds or reactive radical species generated during lignin depolymerization (By similarity).

Belongs to the GMC oxidoreductase family.

65.163 kDa

MLSRVAKLNSRLVSLALLGSQIAFGAITYQHPDDLPSGVDYDFIVAGGGTAGLVVASRLSENSKWNVLVIEAGPSNKDTPETRIPGLADNLPGTRTDWNYTTIPQDALGGRSLNYSRAKVLGGCSTHNGMVYTRGPRDDWNYWAEITDNQALKWDNVLPIMKNTEKFSQDFLDQSMEGHIDPSVHGFDGMLSVVASYTNVSFNNLLLETTRELSDEFPFKLDLNDGKPHGLAWTQYTIDQGAERSSSATSYLESTGDNVHVLVNTHVTRIVSAGNETDFRSVEFAVDANSPKKVLTAKKELILSAGVIASPQILMNSGIGGREELQAIGVDTLIDNPSVGRNLSDQASTLLMFDTTLPNTDYDVAAALTEWDNSRSGPMAYAARLNHLTWVRLPDDKLSGSDPSSGHDSPHIEFQFRQISHQLPPADVPNQVQLPDPDSIGVVLQFSVVNLYSISLGSVTLNNNDPFADPIIDLNMFGDQKDIAILREGVRSARRMFSSQAFKNVVHETVYPPAGVTSDEDLDAFLRTSAVSYLHGVGTLSMSPHSASWGVVNPDFRVKGTTGLRVVDASVIPRAPAGHTQIPVYTFAEHASALIADSYN

PDH2

Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial

363 amino acids

The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).

39.176 kDa

MLGILRQRAIDGASTLRRTRFALVSARSYAAGAKEMTVRDALNSAIDEEMSADPKVFVMGEEVGQYQGAYKITKGLLEKYGPERVYDTPITEAGFTGIGVGAAYAGLKPVVEFMTFNFSMQAIDHIINSAAKSNYMSAGQINVPIVFRGPNGAAAGVGAQHSQCYAAWYASVPGLKVLAPYSAEDARGLLKAAIRDPDPVVFLENELLYGESFPISEEALDSSFCLPIGKAKIEREGKDVTIVTFSKMVGFALKAAEKLAEEGISAEVINLRSIRPLDRATINASVRKTSRLVTVEEGFPQHGVCAEICASVVEESFSYLDAPVERIAGADVPMPYAANLERLALPQIEDIVRASKRACYRSK

PDH2

Pigment-dispersing hormone type 2

80 amino acids

The pigment-dispersing hormone causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neuromodulator (By similarity).

Belongs to the arthropod PDH family.

8.67 kDa

MARCFVVLAFLALAAMSLQVATAQDDLKYFEREVVAELAAQILRVAQGPSAFVAGPHKRNSELINSLLGIPKVMNDAGRR

PDH2

Pigment-dispersing hormone 2 peptides

78 amino acids

The pigment-dispersing hormone causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neuromodulator (By similarity).

Belongs to the arthropod PDH family.

8.344 kDa

MRSGVFVAVLVVVVFALLTQGQELHVPEREAVANLAARILKIVHAPHDAAAGVPHKRNSELINSLLGISALMNEAGRR