PARN

Poly(A)-specific ribonuclease PARN

689 amino acids

3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs. Essential for early development, possibly by participating in silencing certain maternal mRNAs translationally. May have a pivotal role in stress response.

Belongs to the CAF1 family.

78.01 kDa

MRRHKRWPLRSLVCSFSSSAAETVTTSTAASATAAFPLKHVTRSNFETTLNDLRSLVKAADFVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDSRTQSFVSYPHNFFVFPRQELTFDPPAHEFLCQTTSMDFLAKYQFDFNTCIHEGISYLSRREEEEASKRLKMLHGEDGIDSSGETEELKLVRLADVLFAARMEKLLNEWRSGLLHGGNASSEFPRISNGSNQSMETVFHHMRPALSLKGFTSHQLRVLNSVLRKHFGDLVYIHSNDKSSSSRDIVVYTDSDSDKENLMKEAKDERKRLAERKIQSAIGFRQVIDLLASEKKLIVGHNCFLDIAHVYSKFVGPLPSTAEKFVASINSHFPYIVDTKILLNVNPMLHQRMKKSSTSLSSAFSSLCPQIEFSSRSSDSFLQQRVNIDVEIDNVRCSNWNAGGKHEAGYDAFMTGCIFAQACNHLGFDFKQHSQLDDFAQNEKLEKYINRLYLSWTRGDIIDLRTGHSNADNWRVSKFKYENIVLIWNFPRKLKARGIKECICKAFGSASVTSVYHVDDSAVFVLFKNSELVWDFLALKRQLESSDGPVSVLHPLSKILEGGNTGAADYEAYKEICSSHVSEVMFSDQAETVGVKSRTRPNAQCETETREENTVTVTHKASDLIDAFLANRVEVETATSN

parn

Poly(A)-specific ribonuclease PARN

660 amino acids

3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early embryonic development (By similarity).

Belongs to the CAF1 family.

75.261 kDa

MEVTRQNFKEVLPEVCNAVQEADFISIDGEFTGISDGPSVSALTNGLDTPEERYTKLRKHSMNFLLFQFGVCTFRYDQNQSTYITKAFNFYIFPKPFSRTSPDIKFICQSSSIDFLASQGFDFNKVFRSGIPYLNQEEECQLREQYEERRGQMNGAGPVSYTPPSGTGVCNVPEDQREFIRSVEEKVEALLKNTDQTLDLEPCTGFQRKLIYQTLNSKYSKGLHVEALETEKKERFIQISKVDDEERRRREQQKQQREQEELNDAVGFSRVIRAISKSGKLVVGHNMLLDVMHTIHQFCGPLPEELDDFKEVAMTVFPRLLDTKLMASTQPFKEIIHNTSLAELHKQLRQKPFRPPTTECPEGLQSYDTSTEQLHEAGYDAFITGLCFISMANYLGSFLTPPKSHISARSKLLEPFYNKLFLMRVIDIPYLNMSGPDLQPKRDHVLYVTFPKEWKTSDLYQLFSAFGNIQVSWVDDTSAFVSLSQTEQVQIAMNTSRYAESYRIQTYAEYLQSRQKNTHSSRKWASDGWADTSYPSVAMTTASGYSHTDNWHQAVKRSISPSLDEQNHGADSSWTNYSVKKIKTEGSCTQTYADVAGSCDWPRLQADEGGASVSPVAEEAELDEFSANQSQGKRSRKHKKRKSDASETTPPALFDVPQVW

PARN

Poly(A)-specific ribonuclease PARN

639 amino acids

3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early embryonic development. Interacts with both the 3'-end poly(A) tail and the 5'-end cap structure during degradation, the interaction with the cap structure being required for an efficient degradation of poly(A) tails. Involved in nonsense-mediated mRNA decay, a critical process of selective degradation of mRNAs that contain premature stop codons. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly via its interaction with KHSRP. Probably mediates the removal of poly(A) tails of AREs mRNAs, which constitutes the first step of destabilization (PubMed:10882133, PubMed:11359775, PubMed:12748283, PubMed:15175153, PubMed:9736620). Also able to recognize and trim poly(A) tails of microRNAs such as MIR21 and H/ACA box snoRNAs (small nucleolar RNAs) leading to microRNAs degradation or snoRNA increased stability (PubMed:25049417, PubMed:22442037).

Belongs to the CAF1 family.

73.451 kDa

MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW

PARN

Poly(A)-specific ribonuclease PARN

639 amino acids

3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early embryonic development. Interacts with both the 3'-end poly(A) tail and the 5'-end cap structure during degradation, the interaction with the cap structure being required for an efficient degradation of poly(A) tails. Involved in nonsense-mediated mRNA decay, a critical process of selective degradation of mRNAs that contain premature stop codons. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly via its interaction with KHSRP. Probably mediates the removal of poly(A) tails of AREs mRNAs, which constitutes the first step of destabilization (By similarity). Also able to recognize poly(A) tails of microRNAs such as MIR21 and H/ACA box snoRNAs (small nucleolar RNAs) leading to microRNAs degradation or snoRNA increased stability (By similarity).

Belongs to the CAF1 family.

73.43 kDa

MEIIRSNFKCNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSPPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFSPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYVGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYALQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAVSISKNSPATLFEVPDTW

PARN

Poly(A)-specific ribonuclease PARN

638 amino acids

3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early embryonic development. Involved in nonsense-mediated mRNA decay, a critical process of selective degradation of mRNAs that contain premature stop codons. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly via its interaction with KHSRP. Probably mediates the removal of poly(A) tails of AREs mRNAs, which constitutes the first step of destabilization (By similarity). Interacts with both the 3'-end poly(A) tail and the 5'-end cap structure during degradation, the interaction with the cap structure being required for an efficient degradation of poly(A) tails (By similarity) (PubMed:10698948, PubMed:9736620). Also able to recognize poly(A) tails of microRNAs such as MIR21 and H/ACA box snoRNAs (small nucleolar RNAs) leading to microRNAs degradation or snoRNA increased stability (By similarity).

Belongs to the CAF1 family.

73.182 kDa

MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQSNGAGALSYTSPNTSKCPVTIPDDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLNEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKSHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVPIAVNTSKYAESYRIQTYADYVGKKREEKQMKRKWTEDSWKEVEPKRLNTQCGSYSLQNHHYHANSLTATSTVGKRNLSPSRAEAGLEARASGEISDTELEQTDPCAEPLSEGRKKAKKLKRMKKDLSPTGSISDSSAKLFEVPDTW

parn

Poly(A)-specific ribonuclease PARN

631 amino acids

3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs. Required during meiotic maturation to silence certain maternal mRNAs translationally. Does not require an adenosine residue at the 3' end, however, the addition of 25 non-adenylate residues at the 3' terminus, or a 3' terminal phosphate is inhibitory. Involved in dormant mRNAs regulation during oocyte maturation by counteracting polyadenylation mediated by papd4/gld2nt in immature eggs. During maturation it is excluded from the ribonucleoprotein complex, allowing poly(A) elongation by papd4/gld2nt and activation of mRNAs.

Belongs to the CAF1 family.

72.846 kDa

MEITRSNFKDTLPKVYKAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYTKLKKHSMEFLLFQFGLCTFNYDNTEAKYLMKSFNFYIFPKPFNRNSPDKKFVCQSSSIDFLANQGFDFNKVFRNGIPYLNQEEERVLRDQYEDRRSQSNGASTMSYISPNSSKTPVSIPDEQKGFIDKVVERVEDFLKNEQKSMNVEPCTGYQRKLIYQTLNWKYPRGIHVETVESEKKERYIVISKVDEEERKRMEQQKQAKEREELDDAVGFSRIIQAISSSGKLVVGHNMLLDVMHTIHQFFCQLPDELNEFKEVTNCVFPRVLDTKLMASTNPFKEIIYNTSLAELEKRLKEAPFKPPKVDSAEGFQSYNTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKDYVSCRSKIVRPFFNKLFLMRIMDIPYLNLEGPDLQPKRDNVLHVTFPKEWKTSDLYQLFSAFGNIQVSWIDDTSAFVSLSQPEQVQIAVNTSKYAESYRIQTYAEYIEKKNDESQTKRKWAEDGWKDLERKRLKTQYNSYIPQNPVFYGNCFAPSFAVKRSMSPIQEEAASDDTEEVHTHENDPSNPGATEQGKKPKNHKRQKIDSAPPETSDGGSSVLFEVPDTW

Parn

Poly(A)-specific ribonuclease PARN

624 amino acids

3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early embryonic development. Interacts with both the 3'-end poly(A) tail and the 5'-end cap structure during degradation, the interaction with the cap structure being required for an efficient degradation of poly(A) tails. Involved in nonsense-mediated mRNA decay, a critical process of selective degradation of mRNAs that contain premature stop codons. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly via its interaction with KHSRP. Probably mediates the removal of poly(A) tails of AREs mRNAs, which constitutes the first step of destabilization (By similarity). Also able to recognize poly(A) tails of microRNAs such as MIR21 and H/ACA box snoRNAs (small nucleolar RNAs) leading to leading to microRNAs degradation or snoRNA increased stability (By similarity).

Belongs to the CAF1 family.

71.559 kDa

MEIIRSNFKINLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTSGFDTPEERYQKLKKHSMDFLLFQFGLCAFKYDHTDSKHVTKSFNFYVFPKPFSRSSPDVKFVCQSSSIDFLASQGFDFNKVFCSGIPYLNQEEERQLREQFDEKRSQANGAGALAKCPVTIPEDQKKFIDQVIEKIEDFLQSEEKRSLELDPCTGFQRKLIYQTLSWKYPKGIHVETLETDKKERHIVISKVDEEERKRREQEKYTKEQEELNDAVGFSRVIHAIANSGKLVVGHNMLLDVMHTIHQFYCPLPADLNEFKEMAICVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFDPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSLLSPPKMCVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVQIAVNTSKYAESYRIQTYAEYVGKKQEGKQVKRKWTEDSWKEVDRKRPHMQGPCYHSNSFTAAGVLGKRTLSPDPREAALEDRESEEVSDSELEQTDSCTDPLPEGRKKSKKLKRMKKELSLAGSVSDSPAVLFEVPDTW