PAK1IP1

p21-activated protein kinase-interacting protein 1

392 amino acids

Negatively regulates the PAK1 kinase. PAK1 is a member of the PAK kinase family, which has been shown to play a positive role in the regulation of signaling pathways involving MAPK8 and RELA. PAK1 exists as an inactive homodimer, which is activated by binding of small GTPases such as CDC42 to an N-terminal regulatory domain. PAK1IP1 also binds to the N-terminus of PAK1, and inhibits the specific activation of PAK1 by CDC42. May be involved in ribosomal large subunit assembly.

44.049 kDa

MEVVAGCYEQVLFGFAVHPEPVGDGHRERWAPVADFTHHAHTASLSAVAVNSRFVVTGSKDETIHIYDMKKKVDHGALMHHNGTITCLKFHGNRHLISGAEDGLICVWDARRWECLKSIRAHKGHVTFLSIHPSGRLALSVGTDKTLRTWNLVEGRSAFIKNIKQSAHIVEWSPKGEKYVVVILNRIDVYQLDTASVSGTITNERRVSSVTFLSESVLTVAGDEEVVRFFDCDSLTCLSEFKAHENRVKDMFSFETPEHHVLVTASSDGFIKMWKLKQDKKVSPSLLCEINTNARLTCLGVWLDRRTDTKESPPAAAEPAPVSKEQSRRNKEESGHAVQEEEKQPKPDTEKCSLTGDSNKPTRGNSLVSAKKRKTVEMLEKKRKKKKIRMMQ

PAK1IP1

p21-activated protein kinase-interacting protein 1

392 amino acids

Negatively regulates the PAK1 kinase. PAK1 is a member of the PAK kinase family, which has been shown to play a positive role in the regulation of signaling pathways involving MAPK8 and RELA. PAK1 exists as an inactive homodimer, which is activated by binding of small GTPases such as CDC42 to an N-terminal regulatory domain. PAK1IP1 also binds to the N-terminus of PAK1, and inhibits the specific activation of PAK1 by CDC42. May be involved in ribosomal large subunit assembly (PubMed:24120868).

43.964 kDa

MELVAGCYEQVLFGFAVHPEPEACGDHEQWTLVADFTHHAHTASLSAVAVNSRFVVTGSKDETIHIYDMKKKIEHGALVHHSGTITCLKFYGNRHLISGAEDGLICIWDAKKWECLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSPRGEQYVVIIQNKIDIYQLDTASISGTITNEKRISSVKFLSESVLAVAGDEEVIRFFDCDSLVCLCEFKAHENRVKDMFSFEIPEHHVIVSASSDGFIKMWKLKQDKKVPPSLLCEINTNARLTCLGVWLDKVADMKESLPPAAEPSPVSKEQSKIGKKEPGDTVHKEEKRSKPNTKKRGLTGDSKKATKESGLISTKKRKMVEMLEKKRKKKKIKTMQ

Pak1ip1

p21-activated protein kinase-interacting protein 1

382 amino acids

Negatively regulates the PAK1 kinase. PAK1 is a member of the PAK kinase family, which has been shown to play a positive role in the regulation of signaling pathways involving MAPK8 and RELA. PAK1 exists as an inactive homodimer, which is activated by binding of small GTPases such as CDC42 to an N-terminal regulatory domain. PAK1IP1 also binds to the N-terminus of PAK1, and inhibits the specific activation of PAK1 by CDC42. May be involved in ribosomal large subunit assembly.

42.116 kDa

MELVAGSYEQVLFGFTVQRGPAKSGHQETWTPVADFTHHSHTASLSVLASNSRYVVSGSKDETIHIYDMKRKVEHGALVHHAGTVTCLKFHGNQHLISGAEDGHICIWDVKRWKCLKTFKAHRGHVTFLSIHPSGKLALSVGTDKTLRTWNLIEGRSAFIKNIKENAHIVEWSPSGGKYIVVVQNKVDVYRLGTASVSGTITNGKRISSVTFLSDSVLAVAGDEEVVRIFDCDSLECLCEFRAHENRVKDMVSFEVPDHHVLVTASNDGFIKMWTLPQDKKVPPSLLCEAKTGARLTCLTVWLDRAANGMASLPPAAEPCPDQPKTIEKESGDTVQEETSEPNSEKSDVSGDSKQPTKGNSPVTAKKRKMATMSEKKRKKKM

PAK1IP1

p21-activated protein kinase-interacting protein 1-like

369 amino acids

Negatively regulates the PAK1 kinase. PAK1 is a member of the PAK kinase family, which has been shown to play a positive role in the regulation of signaling pathways involving MAPK8 and RELA. PAK1 exists as an inactive homodimer, which is activated by binding of small GTPases such as CDC42 to an N-terminal regulatory domain. PAK1IP1 also binds to the N-terminus of PAK1, and inhibits the specific activation of PAK1 by CDC42. May be involved in ribosomal large subunit assembly.

41.232 kDa

MELVAGCYEQILFGFAARPGEPWTVTPDFTHHAHTASLSAVAVNSKYVVTGSRDESIQIYDMRKKVEHGALLQHNGTITCLEFYGTAHLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGEKYVTVITNKVDIYKLDTASITGTITIEKRISSIRFITDSVLAIAGDDEIIRFYSCDSQKCLCEFKARENRIKDIYSFEREGQHVIVTASSDGYIKVWNLDLNKINNVPSLLCEVSTKARLTCLAVWLDQASEMKENCGKAATSTEANESEKPSAVKKKKVCGMNKSGKLTKQRRRIVPAKRKLEAPLQKKKKKKQNSSE

pak1ip1

p21-activated protein kinase-interacting protein 1-like

368 amino acids

Negatively regulates the PAK1 kinase. PAK1 is a member of the PAK kinase family, which has been shown to play a positive role in the regulation of signaling pathways involving MAPK8 and RELA. PAK1 exists as an inactive homodimer, which is activated by binding of small GTPases such as CDC42 to an N-terminal regulatory domain. PAK1IP1 also binds to the N-terminus of PAK1, and inhibits the specific activation of PAK1 by CDC42. May be involved in ribosomal large subunit assembly.

40.901 kDa

MSECFTVMGDHIELVAGCYEQIVFGYRVCPADEEWTIEPTFTHHAHTASLNAVSSSNQFIATGSKDETIQLYDMCKKTEHGALLHHDGTISCLEFYGTSHLLSGGQDGLICVWSTKKWECLKTIRAHKGQVTSLSVHPSGKLALSVGTDKTLRTWNLIEGRSAFIKNIKQNAEIVLWSPDGDKYAVVVNDKVDIYTLDSATIIGTIAFTKRISCLKFLKNSLLAVGGDDESVRIYDVTSQKCVCEFKAHENRVKAIESFMKDDFCVLVTASNDGFIKLWKLNLESIESPTLLGQLNTTARLTCLCVWMPGETKETAEQPAQATTSEDVLDPLVPVRSKRVRILGEEVIMEDEKGSKTQGKKKKRQKVQ

pak1ip1

p21-activated protein kinase-interacting protein 1-like

363 amino acids

Negatively regulates the PAK1 kinase. PAK1 is a member of the PAK kinase family, which has been shown to play a positive role in the regulation of signaling pathways involving MAPK8 and RELA. PAK1 exists as an inactive homodimer, which is activated by binding of small GTPases such as CDC42 to an N-terminal regulatory domain. PAK1IP1 also binds to the N-terminus of PAK1, and inhibits the specific activation of PAK1 by CDC42. May be involved in ribosomal large subunit assembly.

40.531 kDa

MEESIKLLVGCYEQVLFGYRVHREGEQWLSSADFTHHAHTASVSVLAVNNRFVATGSRDETIQIYDMKKKVEHGALLHHNGTITCLEFYGNTHLLSGAEDGLICVWNTKKWECQQTFKAHKGQVLSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKKNAHIVHWSPSGEKYVVVIHDTVDVYQLETAAVVGTINNPKRISSAQFITDALIAVAGDEEVIRLYDTASQKCVCEFKAHENRVKNLHVIELQGTHVVVSSSSDGYIKMWRIDMEKVQTSPSLLCEVSTSARLTCLSAWLPSGVDHKEKSNTAVTASAVKDCDRPKKKKAQNETTDKEASETQVVHKKRKPETKQKKKKPS